SecReT4
Protein ID: 345429751
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11750
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1174227..1174670 [+]
Producthypothetical protein
Component typeTfc24
UniProt IDE1W4I8
KEGG IDhpr:PARA_11750
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 1.2e-38, Aligned region: 28..140
Protein Sequence: 147 a.a.     [Download]
>gi|345429751|ref|YP_004822869.1| hypothetical protein PARA_11750 [Haemophilus parainfluenzae T3T1]
MVMSIKKSLFLFGLLPLSVFAQGPNPIITVYSTQDYPILHAELASQVYLLDQVEQWENLISQRLSANPSV
AAQQASQIFQSAEWKQSEEQLKRSYQGLISGWQNGIKKVPAVLFQYPGKEDSVIYGETNIAQALSLWQRE
ITKEGTR
 
Nucleotide Sequence: 444 bp     [Download]
>gi|345428590|ref|NC_015964.1|:1174227-1174670 Haemophilus parainfluenzae T3T1, complete genome
ATGGTTATGTCTATAAAAAAATCACTGTTTCTTTTCGGTTTGTTACCACTATCAGTGTTCGCCCAGGGGC
CTAATCCCATAATTACTGTTTATTCAACACAAGATTATCCAATTCTTCACGCAGAGCTTGCAAGCCAGGT
GTATTTACTTGATCAAGTTGAGCAATGGGAAAATTTGATTAGTCAGCGATTGAGTGCGAATCCTAGTGTA
GCAGCTCAGCAAGCATCTCAGATTTTTCAGTCTGCTGAATGGAAACAGTCTGAAGAGCAATTAAAGCGTT
CTTATCAGGGCCTTATAAGTGGTTGGCAAAATGGAATCAAGAAGGTGCCTGCAGTTTTATTTCAATATCC
GGGAAAAGAGGATAGTGTCATATATGGTGAAACCAATATTGCTCAGGCATTAAGTTTATGGCAACGAGAG
ATTACAAAAGAGGGGACAAGATGA
 Primer design