SecReT4
Protein ID: 345429752
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11760
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1174667..1175608 [+]
Producthypothetical protein
Component typeTfc23
UniProt IDE1W4I9
KEGG IDhpr:PARA_11760
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 5.7e-92, Aligned region: 36..299
Protein Sequence: 313 a.a.     [Download]
>gi|345429752|ref|YP_004822870.1| hypothetical protein PARA_11760 [Haemophilus parainfluenzae T3T1]
MKLKKMTLSGLCIAIALTSISGQASESGQSSLNTASIMASSASTSCLDYKVVGTCFWLFCTKFGCKIRTS
TKIKHYIPEVVVSSYNHQAQNPWVEMNFLSNGVKGGDYQSPHKDYTQATFKNVDVIGHPQGAISQMLNST
GYYCKSQTTPFVPYYLSGLDFLAWRFGVPEMVYPEALIPGMREIRANGDTWGNIYPRAGTVTQVHDYKAS
AVTAHRVADVVTNTFQPHVYIPIAKKDNQSNGEWFPPPVKEGDEKTHKWQQLHPVTSQSCAIFPDNPPSM
LSENGSYAWALWRPYKCCKKRGQTFLYSIDWSN
 
Nucleotide Sequence: 942 bp     [Download]
>gi|345428590|ref|NC_015964.1|:1174667-1175608 Haemophilus parainfluenzae T3T1, complete genome
ATGAAATTGAAAAAAATGACATTATCCGGGCTTTGTATTGCAATTGCGTTGACCAGTATTTCAGGACAAG
CTTCGGAGTCCGGTCAATCTTCTTTAAACACTGCATCGATTATGGCATCAAGCGCTTCGACAAGTTGTTT
AGATTATAAGGTCGTTGGTACTTGTTTTTGGCTATTTTGTACAAAATTCGGCTGTAAAATCCGGACATCT
ACGAAAATAAAACACTATATTCCCGAGGTAGTGGTTTCAAGTTATAACCATCAGGCTCAAAATCCTTGGG
TGGAAATGAATTTCCTTAGCAATGGGGTAAAAGGTGGAGATTATCAATCACCACACAAAGACTATACGCA
AGCAACATTTAAAAATGTTGATGTAATCGGTCATCCGCAGGGAGCGATTAGTCAAATGCTTAATAGTACA
GGGTATTACTGCAAAAGTCAGACAACGCCTTTTGTGCCTTATTACTTGAGTGGTTTGGACTTTTTAGCGT
GGCGATTTGGTGTTCCGGAAATGGTTTATCCTGAAGCGCTTATTCCAGGTATGAGAGAAATTAGAGCAAA
TGGAGACACTTGGGGAAATATTTATCCACGAGCGGGTACAGTAACACAAGTTCATGACTATAAAGCTTCA
GCTGTAACAGCGCATCGAGTAGCAGATGTTGTGACAAATACTTTCCAACCACATGTATATATACCGATTG
CGAAAAAAGATAATCAATCGAATGGTGAGTGGTTTCCCCCTCCAGTGAAAGAAGGGGATGAAAAGACACA
TAAATGGCAACAGCTTCACCCGGTTACTTCACAGTCTTGTGCTATTTTCCCTGATAACCCGCCAAGTATG
CTATCTGAAAATGGTAGTTATGCCTGGGCATTATGGCGCCCTTACAAGTGCTGTAAAAAACGCGGACAAA
CATTTTTGTATAGTATTGATTGGTCTAATTAA
 Primer design