SecReT4
Protein ID: 345429753
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11770
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1175623..1177623 [+]
Producthypothetical protein
Component typeTfc22
UniProt IDE1W4J0
KEGG IDhpr:PARA_11770
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 666 a.a.     [Download]
>gi|345429753|ref|YP_004822871.1| hypothetical protein PARA_11770 [Haemophilus parainfluenzae T3T1]
MKLNHALKASYIAISCAILSSTMPVSASNSNPFGFNKADSILSDMVFYQIGGGVGYMAPPSRGTIPAAEF
GIGWKANLMCGNFDIKTSIKNQLNGLTEGFKDLYSNVIESATGAVASLPAMVIQRANPQLYDILTNGLYQ
GKIDFNSLKTSCEEMSKKLADATLNGRWSQSSDMESFKDITSTEPDATRAKKRLEESQGKEGKEWVGGKK
RGGQGQEPIKIVEDVAKAGYNMQNKRNVLESGRISGSSCSGLLCQTWDNPKDMTDWLTNVIGEKQLTTCK
TDCGTASSSRAGVGLTPEIEKENIKTVTQLQKALNMSTPSVEVLAELSSTTVPVTRGLIESLREDPDAQV
LGQRLASEIAVAKTMEKMLLARRAVLTGMREPNVANNKDAQEELEKILTLIDREIGQIRMEIDLQKSLTG
NSAVAILQNKELREYNTGTGNVTRDSVDKRISDLANGTNSNAAELADADNINIPRNNVTLEVPQMSNSLS
YTGTGGTSGNSRGNTSYSSVPAIKGTALDQATGLLKKFEGFSDKAYWDVNAYRTGYGSDTITKADGTIVK
VTKDTVVSRADAERDLARRTQEFANRARNNVSSSTWDKLPPNAQAALTSYAYNYGSLTKDVIAAAQASAQ
SGDMNALANAVRNRQNNNNGVNAKRRNQEADYILGK
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|345428590|ref|NC_015964.1|:1175623-1177623 Haemophilus parainfluenzae T3T1, complete genome
ATGAAATTAAATCATGCACTGAAAGCATCTTATATTGCTATATCGTGCGCAATCTTATCCTCAACCATGC
CAGTATCAGCTTCTAATAGTAATCCGTTTGGATTTAATAAAGCCGATTCTATTTTGTCTGATATGGTGTT
TTATCAAATTGGGGGCGGTGTAGGTTATATGGCTCCCCCGAGTCGAGGTACGATTCCTGCAGCTGAATTT
GGGATTGGTTGGAAAGCTAACTTGATGTGCGGTAATTTTGACATTAAGACGAGTATTAAAAATCAGTTAA
ATGGTTTAACTGAAGGATTTAAAGATCTTTATAGTAACGTTATCGAATCAGCCACAGGAGCTGTGGCGAG
TTTACCTGCAATGGTTATTCAACGAGCAAATCCTCAGTTATACGATATTCTTACGAATGGTTTATATCAA
GGTAAAATTGATTTTAATAGCTTAAAAACCAGCTGTGAAGAAATGTCTAAGAAGCTTGCAGACGCAACTT
TAAATGGTCGTTGGTCTCAAAGTTCGGATATGGAATCCTTTAAAGACATTACTTCAACTGAACCAGATGC
TACTCGAGCTAAAAAGAGACTTGAGGAATCTCAAGGTAAGGAAGGTAAAGAGTGGGTCGGGGGTAAAAAA
CGCGGTGGCCAAGGACAAGAACCAATCAAAATTGTTGAGGATGTTGCAAAAGCTGGCTACAACATGCAAA
ACAAGCGTAATGTATTAGAATCAGGTCGAATCTCCGGTAGTAGTTGTAGCGGATTACTTTGTCAAACTTG
GGATAATCCTAAAGATATGACAGATTGGTTAACGAATGTGATCGGTGAGAAGCAATTAACTACTTGTAAA
ACAGATTGTGGTACTGCTAGTAGCTCTCGAGCTGGTGTTGGTTTAACACCTGAAATTGAAAAAGAAAATA
TTAAGACGGTAACTCAATTACAAAAAGCGCTTAACATGAGCACGCCTTCCGTTGAAGTACTTGCAGAATT
AAGTTCTACAACAGTTCCTGTAACTCGTGGCTTAATTGAGTCTTTACGAGAAGATCCCGATGCTCAAGTA
TTAGGGCAGCGTTTAGCCAGTGAAATTGCTGTAGCTAAAACAATGGAGAAAATGCTTCTTGCACGTCGAG
CTGTTTTAACGGGTATGCGTGAGCCAAATGTGGCCAACAATAAAGATGCTCAAGAAGAGTTAGAAAAGAT
CCTCACTTTAATTGACCGAGAAATAGGTCAAATTAGAATGGAGATTGATCTACAAAAATCACTTACCGGG
AATTCCGCGGTGGCGATTCTACAAAATAAAGAGCTACGTGAATATAACACTGGAACTGGAAATGTTACAC
GTGACAGTGTAGATAAACGGATTAGCGATTTAGCTAATGGTACGAATAGCAATGCGGCTGAATTGGCAGA
TGCTGACAATATCAATATTCCTCGTAACAATGTCACTTTAGAAGTGCCTCAGATGTCAAACTCCCTGTCT
TACACAGGGACTGGCGGTACATCCGGAAATAGTAGAGGTAACACTTCTTATTCATCAGTTCCAGCAATTA
AAGGGACTGCACTTGATCAAGCAACAGGGTTGTTGAAAAAATTTGAAGGGTTTAGTGATAAAGCATATTG
GGATGTCAATGCTTATCGCACCGGATATGGTTCAGATACTATCACAAAAGCGGATGGTACAATTGTCAAA
GTAACGAAAGATACTGTAGTTAGTCGTGCTGACGCAGAGCGTGATTTAGCACGTCGCACACAAGAGTTTG
CAAATAGAGCAAGAAATAACGTATCATCTTCAACATGGGATAAGTTACCACCAAATGCTCAAGCTGCATT
AACATCTTATGCCTATAACTACGGGTCATTAACAAAAGATGTGATTGCCGCAGCCCAAGCATCTGCGCAA
TCAGGCGATATGAACGCACTAGCAAATGCAGTAAGAAATCGTCAAAATAACAATAATGGTGTAAATGCTA
AACGTCGTAACCAAGAAGCAGATTACATTTTAGGAAAATAA
 Primer design