SecReT4
Protein ID: 345429754
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11780
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1177635..1178042 [+]
Producthypothetical protein
Component typeTfc21
UniProt IDE1W4J1
KEGG IDhpr:PARA_11780
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|345429754|ref|YP_004822872.1| hypothetical protein PARA_11780 [Haemophilus parainfluenzae T3T1]
MKKLLTIAAVAVCATPAFAANNIFSCTAENGSPVSVVKNGSDYEFTYGQVSFKNPVKQVFANQDSYVATG
SGFITSSLEMRNNGTSYTIQFVQPHNSNSIEEPMLYITNGSKMDTVSCKAGSATQNFERRSMKVS
 
Nucleotide Sequence: 408 bp     [Download]
>gi|345428590|ref|NC_015964.1|:1177635-1178042 Haemophilus parainfluenzae T3T1, complete genome
ATGAAAAAATTACTCACTATTGCAGCGGTTGCTGTGTGTGCAACACCTGCATTTGCAGCTAATAATATTT
TTTCTTGTACGGCAGAGAACGGAAGCCCGGTATCTGTAGTAAAGAATGGTTCAGACTATGAATTTACTTA
TGGCCAAGTTTCTTTTAAAAATCCGGTAAAACAAGTTTTTGCTAATCAGGATTCTTATGTAGCTACTGGT
TCAGGGTTTATTACTAGCTCATTAGAAATGAGAAATAATGGCACAAGTTACACGATTCAATTTGTGCAAC
CACACAATAGTAACAGTATTGAAGAGCCAATGCTTTATATCACCAATGGCAGTAAAATGGATACGGTGAG
CTGTAAAGCGGGTAGTGCAACTCAAAACTTTGAACGTCGCAGTATGAAAGTTTCATAA
 Primer design