SecReT4
Protein ID: 345429756
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11800
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1178464..1178820 [+]
Producthypothetical protein
Component typeTfc20
UniProt IDE1W4J3
KEGG IDhpr:PARA_11800
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 118 a.a.     [Download]
>gi|345429756|ref|YP_004822874.1| hypothetical protein PARA_11800 [Haemophilus parainfluenzae T3T1]
MDAQKFGHSVGQFFKKIDRTLSFLPGKPRKAVVTAAALAASPILAGVIISKAKSFKETDYGSGAENKSIM
NTLLEFEEHEDGYRDGPEGVGFYSFGTRIDVEDDVDTFEHMNEFYEIK
 
Nucleotide Sequence: 357 bp     [Download]
>gi|345428590|ref|NC_015964.1|:1178464-1178820 Haemophilus parainfluenzae T3T1, complete genome
ATGGATGCTCAAAAATTTGGCCATTCTGTCGGACAATTTTTTAAGAAAATTGACCGCACTTTATCATTTC
TCCCAGGAAAGCCTCGTAAAGCTGTTGTGACAGCTGCGGCTCTTGCTGCGAGTCCAATTTTGGCCGGAGT
TATAATTTCTAAAGCTAAATCCTTTAAAGAGACTGATTATGGCAGTGGTGCTGAGAATAAATCCATAATG
AATACGTTGTTAGAATTTGAAGAACATGAGGATGGCTATCGAGATGGCCCTGAGGGGGTTGGTTTTTATT
CTTTTGGAACAAGAATTGATGTTGAGGATGACGTAGATACATTTGAACACATGAATGAGTTTTATGAGAT
AAAATAA
 Primer design