SecReT4
Protein ID: 345429757
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11810
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1178846..1180342 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDE1W4J4
KEGG IDhpr:PARA_11810
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 3.4e-111, Aligned region: 10..485
Protein Sequence: 498 a.a.     [Download]
>gi|345429757|ref|YP_004822875.1| hypothetical protein PARA_11810 [Haemophilus parainfluenzae T3T1]
MTFSVDSYLEYFLTLLGWLLNNGVFALFVGTGLWLLPLIGMIFKIWRDVAKQGDDEGEKGDLLIRWLTIE
LLPAMLIVVLTLAPLIPVSLNNLEYNERSSIQCGYKVPASPDKSGYAPFTTTFGDRQARIPIWWMLMHKV
DKGLTYGMTAVLPCQRDLRQVRFEVQHQKITNPALLTEVQQFVQQCYIPARQKLQTSQIALSPAQIRETS
WLGGKLLINNSELYPRFRAQQPISTFPYDANRDAALPNSGKGGFPSCDQWWDEGGAGLKSRLLTDMRQNL
SAQVSDFFNSIDNQDEALLRTLLRSENIDVSKGKMYQGYGGSVEFGFWNAITRLTSTVGTAVGSLAIFPG
LDAMRQALPMVQSFMIMALIVLIPVITILSGFSIKAVVTLSFVYFALITTTFWWELARWLDSYMIEIMYS
SPSHNSFNINFLENAQDDIISNFVMGSMFIFLPTLWFGAMSWAGINMGGAMSQALKQGSNHASSAGGKGG
ELIQSKLK
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1180342-1178846 Haemophilus parainfluenzae T3T1, complete genome
ATGACATTCTCAGTTGACAGTTATCTTGAATATTTCCTGACTCTACTTGGTTGGTTGCTTAATAACGGAG
TTTTTGCGTTATTTGTTGGAACAGGGTTATGGCTTCTTCCGCTTATCGGAATGATCTTTAAAATTTGGCG
TGACGTAGCTAAACAAGGGGATGATGAAGGTGAGAAAGGGGATTTATTAATCCGCTGGCTCACAATCGAA
CTCCTTCCAGCAATGCTTATCGTTGTTTTGACATTAGCCCCTCTTATCCCGGTATCATTGAATAACCTTG
AATACAATGAACGTTCATCTATTCAATGTGGCTATAAAGTTCCTGCTTCCCCGGATAAATCAGGCTATGC
GCCATTTACGACAACATTTGGAGACAGACAAGCCCGAATTCCTATTTGGTGGATGTTGATGCACAAAGTG
GATAAAGGTCTAACTTATGGTATGACTGCAGTATTGCCTTGCCAGCGTGATTTACGTCAAGTTAGATTTG
AAGTGCAACATCAAAAAATCACTAACCCAGCATTATTAACTGAAGTACAGCAATTTGTGCAACAATGCTA
TATCCCGGCTCGTCAAAAATTACAAACAAGCCAAATTGCCTTGAGTCCGGCACAAATCCGCGAAACATCC
TGGTTAGGTGGTAAATTGCTTATTAATAACAGCGAGCTCTACCCTCGTTTTAGGGCTCAGCAACCTATTA
GCACGTTCCCTTATGATGCAAATCGAGATGCGGCATTACCTAATTCGGGAAAAGGTGGTTTCCCAAGCTG
TGATCAATGGTGGGATGAAGGTGGAGCTGGATTAAAATCTCGCCTACTTACAGATATGCGTCAAAACTTA
TCTGCCCAGGTGAGTGATTTCTTTAATTCTATCGACAATCAAGATGAAGCTTTATTGAGAACACTTTTAC
GTTCTGAAAACATAGATGTTTCAAAAGGGAAAATGTACCAAGGTTACGGTGGTAGTGTTGAATTTGGATT
TTGGAATGCCATCACTCGACTCACCTCAACTGTAGGAACTGCAGTAGGAAGTTTAGCGATATTTCCTGGT
CTCGATGCAATGCGACAAGCCTTGCCAATGGTTCAATCCTTTATGATTATGGCTCTGATAGTTTTAATTC
CAGTCATTACGATTTTAAGTGGTTTTTCAATTAAAGCTGTAGTGACACTAAGCTTTGTATATTTTGCACT
TATTACAACAACGTTTTGGTGGGAATTGGCACGATGGTTAGACTCATATATGATTGAGATTATGTACAGC
TCACCGTCTCATAACTCATTTAATATTAATTTTTTAGAGAATGCGCAAGACGATATTATCTCTAATTTTG
TGATGGGAAGTATGTTTATATTCTTACCAACATTATGGTTTGGCGCTATGTCTTGGGCTGGTATTAATAT
GGGCGGGGCTATGTCTCAAGCGTTAAAACAAGGTTCAAATCATGCTAGTTCAGCAGGGGGAAAAGGCGGA
GAGTTAATTCAAAGCAAGTTAAAATAA
 Primer design