SecReT4
Protein ID: 345429758
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11820
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1180351..1180674 [-]
Producthypothetical protein
Component typeTfc18
UniProt IDE1W4J5
KEGG IDhpr:PARA_11820
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 107 a.a.     [Download]
>gi|345429758|ref|YP_004822876.1| hypothetical protein PARA_11820 [Haemophilus parainfluenzae T3T1]
MSQGEKPQSRGWLKNVLRFIAILLFLFLALTAIGIFATQYLQNVDIRAWFIKTQWIWFAIRLLLYGAIML
MVYSISRRQPSSMPAKAKWLIAMILIFAEAITQITLA
 
Nucleotide Sequence: 324 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1180674-1180351 Haemophilus parainfluenzae T3T1, complete genome
ATGTCTCAAGGTGAAAAGCCACAATCAAGAGGATGGCTTAAAAATGTACTCCGTTTTATTGCTATCCTTT
TATTTTTATTTTTAGCCCTTACTGCAATTGGCATCTTTGCAACTCAATATCTTCAGAATGTTGATATTCG
TGCTTGGTTTATTAAAACGCAGTGGATATGGTTTGCAATACGATTATTACTATATGGTGCGATTATGTTG
ATGGTCTATTCCATTTCTCGTCGCCAACCATCTTCTATGCCGGCAAAAGCAAAATGGTTAATTGCGATGA
TTTTAATTTTTGCTGAAGCGATTACACAGATTACTTTAGCTTAG
 Primer design