SecReT4
Protein ID: 345429759
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11830
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1180684..1181091 [-]
Producthypothetical protein
Component typeTfc17
UniProt IDE1W4J6
KEGG IDhpr:PARA_11830
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|345429759|ref|YP_004822877.1| hypothetical protein PARA_11830 [Haemophilus parainfluenzae T3T1]
MTFHRIFDIGPRIQSLAFTSDEVKAYVLHFIAKIKTKIGSNCQLSAFPQRVFTQSSWKVHAKGDKGEVHL
LFNISGRFQLPVFSSENWPARLNVELTDHVDAYWLIQYLLWKLAAIWESPADLSPVFGDKTVGNE
 
Nucleotide Sequence: 408 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1181091-1180684 Haemophilus parainfluenzae T3T1, complete genome
ATGACTTTTCATCGTATTTTTGACATTGGGCCTCGCATCCAATCACTTGCTTTTACCTCTGATGAGGTGA
AAGCCTACGTGCTGCATTTCATTGCAAAAATTAAGACAAAAATTGGTTCAAACTGCCAATTAAGCGCATT
TCCTCAGCGTGTATTTACTCAATCAAGTTGGAAAGTACACGCTAAAGGAGATAAAGGTGAAGTGCATTTA
TTATTTAATATCTCCGGGCGTTTCCAATTACCTGTGTTTTCTTCCGAAAACTGGCCAGCTAGACTTAATG
TGGAATTAACCGATCACGTTGATGCATATTGGTTAATTCAATATTTGCTTTGGAAATTAGCTGCAATTTG
GGAATCCCCTGCTGACTTATCCCCAGTTTTTGGGGATAAGACTGTGGGTAATGAATAA
 Primer design