SecReT4
Protein ID: 345429760
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11840
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1181099..1183969 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDE1W4J7
KEGG IDhpr:PARA_11840
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7e-64, Aligned region: 72..340
AAA_10 [PF12846], Evalue: 1.5e-33, Aligned region: 534..866
Protein Sequence: 956 a.a.     [Download]
>gi|345429760|ref|YP_004822878.1| hypothetical protein PARA_11840 [Haemophilus parainfluenzae T3T1]
MALFQDVLEAFFPAKKGDKPQPKKEPILTSIAPEEAQPDDTNNVEEAIEITPVMRNRKMTREQHVKMLYG
RDPSFISNLPYAEYLEEEGVMLFDDAKSAGAVFDIKPIGTEGRSSDYLNRVRTLVKDALQDSFDELDTNP
YVVQFYCQDDKDLSGYVENLRQYIKTTSPEASGSAFTEQWLGEMERHLKAVGKPGGLFVDDRVTSTAWAG
KVRKTRMVIYRYAGNNETDTIEKLNTACDRVQSAFITAGLTMERQNETQIHRWLLEWFNPNPSRYFNGLD
DKACYDLLSLSKDESALPLQDQDFSENLFFTPPESKNGYWYFNEQPHEVIVVDNIRKQPDVGHMTGEVTR
GRNINALFDLLPESTIMAITVVIHPQDKLQAHLDKLSSRAVGNNYESIYLKQDALTVTEYLKDGHKLYQA
GMVFYVRGKDDQELRIRSRELRTVLLSNNLVPVKEGNEVAPLNSYLRWLPMNFNPQLDAKSRFYTKYYWV
QHIANMLPVFGRETGTGHPGITYFNRGGSPLDFDPLNPKDRTKNAHKLILGPTGSGKSATLTAQMAQLMA
VHRPRLFIVEAGNSFGLFSDYAERYGLTVNRVSLEPSSNIALPLFSEAHRLLEMDIDLEVQDDDDNEDEG
EEQRDLLAEMELTARLMITGGEAKEDEKMSRADRSAIRQAILLAAEKTSQETPPRQVLTGDVKAALEELS
HRPDIRPERASRLADMAEAMDIFCTGVNGRFFNREGEIWPEADITLVDLAMFARDGYEAELAISYISLIN
HINSLGEKYQHSFRPIVNITDESHIITVNPLLAKFLVKGSKMWRKLGIWLWLATQNMADFPDESDKLLSM
VEWWELLNLSNDEVEQVNRFRRLSEAQKMMLLSAKKADKKYTEGVVLATNMEALFRVVPPSLYLALGMTE
KHEKAQRKQLMMEHNCTELDAALMVAKDLDKKRGIAVNDELNSIAA
 
Nucleotide Sequence: 2871 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1183969-1181099 Haemophilus parainfluenzae T3T1, complete genome
ATGGCATTATTTCAAGACGTGTTAGAGGCTTTCTTCCCGGCTAAAAAGGGTGATAAGCCTCAACCTAAAA
AGGAACCTATCCTAACATCCATTGCACCGGAAGAAGCACAGCCGGATGATACCAATAACGTAGAAGAGGC
GATTGAAATCACTCCTGTTATGCGTAATAGAAAAATGACCAGAGAGCAACATGTTAAAATGCTTTATGGG
CGCGATCCCTCTTTTATTTCCAACCTTCCTTATGCGGAATATTTGGAAGAAGAAGGCGTAATGCTTTTTG
ATGATGCTAAAAGTGCGGGTGCAGTATTTGATATTAAACCTATAGGAACCGAGGGGAGAAGTAGCGATTA
TCTTAATCGTGTTCGCACGTTGGTTAAAGATGCTTTACAAGATAGTTTCGATGAACTTGATACCAATCCT
TACGTCGTACAATTCTATTGTCAGGATGATAAGGATTTAAGCGGTTATGTTGAGAATCTGAGACAGTATA
TTAAAACCACTTCACCTGAAGCGAGCGGTAGTGCGTTTACAGAACAGTGGCTTGGTGAAATGGAGCGTCA
CTTAAAAGCAGTAGGTAAACCAGGTGGGCTTTTTGTTGATGACCGGGTAACAAGTACGGCATGGGCTGGA
AAAGTGCGTAAAACACGCATGGTTATTTATCGTTATGCTGGAAATAATGAGACAGATACAATCGAGAAAT
TAAATACAGCTTGTGATCGTGTTCAAAGTGCTTTTATCACAGCTGGATTAACCATGGAGCGCCAAAATGA
AACACAAATTCATCGTTGGTTATTAGAATGGTTTAATCCAAATCCATCACGCTATTTTAACGGACTCGAT
GACAAAGCTTGCTATGATCTTTTATCACTCTCTAAAGATGAGTCCGCTCTACCATTACAAGACCAAGATT
TTAGTGAAAATCTCTTTTTTACGCCACCGGAAAGTAAAAATGGCTATTGGTATTTTAATGAGCAACCTCA
CGAAGTCATTGTAGTTGATAATATTCGTAAGCAGCCGGATGTTGGCCACATGACAGGCGAAGTCACTCGA
GGTCGTAATATTAATGCACTATTTGATTTATTGCCGGAATCAACCATTATGGCTATCACTGTAGTCATTC
ATCCTCAAGATAAATTACAGGCGCATTTAGATAAATTAAGTAGTCGAGCTGTCGGTAATAACTATGAGTC
TATCTATTTAAAACAAGATGCCCTCACAGTGACTGAATATTTAAAAGACGGACACAAGCTTTATCAAGCT
GGCATGGTTTTCTATGTAAGAGGGAAAGACGATCAAGAGCTACGCATTCGCTCAAGAGAATTAAGAACGG
TTTTACTCAGTAATAATTTAGTGCCGGTAAAAGAAGGTAACGAAGTTGCGCCTCTTAATAGCTATTTACG
CTGGCTACCGATGAATTTTAATCCTCAATTAGATGCAAAATCTCGTTTTTATACCAAGTATTATTGGGTG
CAACACATTGCGAATATGTTACCTGTATTTGGCCGTGAGACAGGAACGGGACACCCAGGGATCACCTATT
TTAACCGCGGTGGAAGCCCATTAGATTTTGACCCACTAAACCCTAAAGACCGGACTAAAAATGCGCATAA
GCTCATTTTAGGCCCTACAGGTTCAGGTAAATCGGCAACATTAACCGCACAAATGGCGCAACTGATGGCT
GTGCACCGTCCTCGCTTGTTTATTGTAGAAGCGGGTAACTCTTTTGGATTGTTTTCAGATTATGCGGAGC
GTTACGGTTTAACGGTTAACCGGGTATCTCTTGAGCCAAGTAGTAACATCGCTTTACCGCTCTTCTCTGA
AGCGCATCGTTTATTGGAAATGGATATCGATCTTGAAGTTCAAGATGATGACGATAATGAAGATGAAGGC
GAGGAACAACGAGACTTACTTGCGGAAATGGAATTAACTGCACGCTTAATGATCACCGGTGGCGAAGCGA
AAGAGGATGAGAAAATGAGTCGTGCTGACCGCTCTGCCATTCGCCAGGCTATTTTATTAGCTGCGGAGAA
AACCTCACAAGAAACCCCGCCTCGTCAAGTATTAACCGGGGATGTTAAAGCCGCACTTGAGGAATTAAGC
CATCGCCCGGATATTCGTCCTGAGCGCGCATCTCGCCTTGCTGATATGGCTGAAGCGATGGATATTTTCT
GTACCGGGGTAAATGGTCGATTCTTTAACCGTGAAGGGGAAATTTGGCCAGAGGCTGATATTACACTCGT
CGATTTGGCGATGTTTGCACGTGATGGCTATGAAGCTGAATTAGCGATTTCGTATATTTCCCTAATTAAC
CATATCAACTCCTTAGGTGAAAAATATCAACACAGTTTCCGCCCTATCGTGAACATTACGGATGAGTCGC
ATATCATTACCGTAAATCCACTTCTAGCGAAGTTCCTGGTTAAAGGTTCTAAAATGTGGCGTAAATTGGG
TATTTGGTTATGGTTGGCTACACAGAATATGGCTGACTTCCCTGATGAATCTGATAAATTACTCAGCATG
GTTGAATGGTGGGAATTACTTAACCTTTCTAATGATGAAGTCGAACAGGTAAACCGTTTCCGTCGTTTAT
CTGAAGCTCAGAAAATGATGTTGTTATCTGCAAAAAAAGCAGATAAGAAATATACTGAAGGTGTGGTGCT
CGCAACCAATATGGAAGCCTTATTCCGTGTTGTTCCACCTAGTCTTTACTTAGCACTAGGGATGACTGAA
AAACACGAGAAAGCACAACGTAAACAATTAATGATGGAACATAACTGTACTGAGTTAGATGCGGCATTGA
TGGTTGCTAAAGACTTAGACAAAAAACGGGGGATTGCAGTCAATGACGAACTTAACTCAATCGCAGCCTA
A
 Primer design