SecReT4
Protein ID: 345429761
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11850
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1183985..1184392 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDE1W4J8
KEGG IDhpr:PARA_11850
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 135 a.a.     [Download]
>gi|345429761|ref|YP_004822879.1| hypothetical protein PARA_11850 [Haemophilus parainfluenzae T3T1]
MKVLMMMGVILAASSVLTGCSTSQGDLLPTGDATMKDIWNRGGNDSNITSYRTPNGRLIDAPNYVSSREQ
QTYTRTAENEVKNLFPRLPNPDLVMYVYPHLTDSSEQMPVPGYSSVIPFYGRVQYAQPGERTRMY
 
Nucleotide Sequence: 408 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1184392-1183985 Haemophilus parainfluenzae T3T1, complete genome
ATGAAAGTTTTAATGATGATGGGCGTGATTTTAGCCGCAAGTAGTGTTTTGACTGGCTGCTCAACGTCTC
AAGGTGATTTATTGCCAACAGGCGATGCAACGATGAAAGATATTTGGAATAGAGGTGGTAATGATAGCAA
TATTACATCTTATCGCACACCAAATGGTCGTCTTATTGATGCACCAAATTACGTTTCATCTCGTGAGCAA
CAAACCTATACCCGCACAGCAGAAAACGAGGTGAAAAACCTTTTCCCTCGTTTACCCAATCCTGATTTAG
TGATGTATGTTTACCCTCACTTAACTGATTCATCAGAGCAAATGCCTGTACCTGGGTATTCTTCTGTTAT
CCCATTTTATGGTCGTGTGCAATATGCCCAACCGGGTGAGCGTACAAGAATGTACTAG
 Primer design