SecReT4
Protein ID: 345429762
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11860
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1184402..1185802 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDE1W4J9
KEGG IDhpr:PARA_11860
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.4e-06, Aligned region: 263..445
Protein Sequence: 466 a.a.     [Download]
>gi|345429762|ref|YP_004822880.1| hypothetical protein PARA_11860 [Haemophilus parainfluenzae T3T1]
MQMKANKAFYVIGGITALVVTLMAGFLFSGSSSTTTAETKKEDALDLSLKDLSPEELRSMGLEGDTSKDT
VRTLIGKVKENNKRFDEVILQNDRLVKENEQLKNQANNTDYQIQQAVQAETGALINEINALKDQVVQAGN
QVVGNGNAQANPNAPLPINGATTGPQVETRGGINWVNPSDMPTTDSQGNALQGIGVNGAGIGFPKTFDNN
VNDIRKSNDGLQSSTGNNAIFNTATPFFTIAANSTLTNSVAMTALVGRVPIDNNVTEPYPFKLLIGRDNL
IANGIELPDIEGAIVSGTASGDWTLSCVRGDVKSLTFVFSDGRIVSTDDSNNKIGWLSDPHGVPCIPGER
RTNAPEYLTTNFFLTGASAAAQGLSSSQSTTVVDGGAVIGAVTGNNGKYILGQALGGGLRETADWFRQRY
GQMFDAVYVPPGKEVAVHIEKQIDIDYDRMSRKVKYGQASRQSNLD
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1185802-1184402 Haemophilus parainfluenzae T3T1, complete genome
ATGCAAATGAAAGCAAATAAAGCGTTCTATGTTATTGGTGGGATTACCGCGCTTGTCGTGACGCTGATGG
CTGGATTTCTTTTCTCCGGTAGTAGCTCAACAACTACAGCAGAAACCAAAAAAGAAGATGCTTTAGATCT
CTCTCTCAAAGATTTATCACCGGAAGAGCTACGCTCAATGGGGCTTGAGGGTGATACATCTAAAGATACG
GTGAGAACACTTATTGGTAAAGTGAAGGAAAATAACAAACGCTTTGATGAAGTGATTTTACAAAATGACC
GCTTGGTAAAAGAGAATGAGCAGTTAAAAAATCAAGCAAATAATACGGATTATCAAATTCAACAGGCGGT
ACAAGCAGAAACAGGGGCGTTAATTAATGAGATTAATGCGTTAAAAGATCAGGTTGTACAAGCTGGTAAT
CAAGTTGTAGGGAATGGAAATGCCCAGGCAAATCCCAATGCTCCTCTACCAATAAACGGAGCAACAACTG
GCCCTCAGGTTGAAACTCGAGGGGGAATTAATTGGGTGAACCCTAGTGATATGCCAACTACAGACAGCCA
AGGGAATGCTCTACAAGGTATTGGTGTAAATGGTGCAGGAATCGGTTTTCCCAAAACCTTCGATAACAAT
GTGAATGACATCCGAAAATCGAATGATGGGTTGCAATCTAGTACCGGTAATAATGCAATATTTAATACCG
CTACACCATTTTTCACAATTGCAGCTAACTCTACCTTAACTAATTCTGTTGCAATGACTGCGCTTGTTGG
GCGTGTGCCGATTGATAATAATGTGACCGAGCCTTATCCGTTTAAATTGCTTATCGGTCGAGATAACTTA
ATTGCAAATGGTATTGAACTGCCGGATATTGAAGGCGCAATTGTCTCTGGAACCGCAAGCGGTGACTGGA
CGCTATCTTGTGTACGTGGTGATGTGAAAAGCTTAACTTTTGTATTTAGCGATGGGCGCATTGTTTCAAC
GGATGATTCTAACAATAAAATTGGCTGGTTATCTGATCCGCACGGTGTGCCTTGCATTCCTGGAGAACGC
AGAACGAATGCTCCGGAATATCTAACAACCAACTTTTTCTTAACGGGGGCTTCCGCAGCTGCACAAGGCT
TATCATCATCTCAATCAACAACAGTGGTTGATGGCGGTGCAGTAATTGGTGCGGTAACGGGTAATAACGG
TAAGTATATTCTTGGTCAAGCGTTAGGTGGCGGTTTGAGAGAAACTGCAGACTGGTTCCGCCAGCGTTAT
GGCCAAATGTTTGATGCGGTATATGTTCCACCGGGTAAAGAAGTGGCTGTACACATCGAAAAACAAATTG
ATATTGATTATGACCGCATGTCTAGAAAAGTGAAATACGGACAAGCCTCAAGACAATCTAACTTGGATTA
A
 Primer design