SecReT4
Protein ID: 345429763
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11870
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1185813..1186682 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDE1W4K0
KEGG IDhpr:PARA_11870
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.3e-116, Aligned region: 3..278
Protein Sequence: 289 a.a.     [Download]
>gi|345429763|ref|YP_004822881.1| hypothetical protein PARA_11870 [Haemophilus parainfluenzae T3T1]
MKKLTLLLSAAFIFSPMTASADVLMKWARKPLPIDLQIEKERILFVDKNVKVGYPPELDSKLRIQSTGGA
VYLKATADFPKTRLQLMDVATGEIILLDVQAKHSVANASEPIRFVYENKVEKQTTAYGQDANAYNEPMPN
ARPALPAPAALTRYAAQMFYAPLRTVEPLEGVRQVSHRLPTPLKTLLPALPVRATPLLSWQLDGYVVTAV
RLQNQGQSRIDLDPRELQGRFYAATFQHNWLGGHGTPEDTTTLYLVTEGSPNHSVIPQSNSYKPKKLKKV
TTTVTTQTK
 
Nucleotide Sequence: 870 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1186682-1185813 Haemophilus parainfluenzae T3T1, complete genome
ATGAAAAAACTCACTTTGTTACTGAGCGCGGCTTTTATCTTTTCACCAATGACGGCATCTGCCGATGTGT
TAATGAAATGGGCACGCAAACCGTTACCTATTGACTTACAAATCGAAAAAGAACGTATTCTATTCGTAGA
TAAAAATGTAAAAGTAGGTTATCCACCTGAATTAGATAGCAAACTTCGCATTCAATCAACTGGCGGTGCG
GTTTATTTAAAAGCAACTGCAGATTTCCCAAAAACACGCTTACAGCTTATGGATGTTGCAACCGGAGAAA
TAATCTTACTTGATGTGCAAGCGAAGCATTCTGTTGCCAATGCAAGTGAGCCAATTCGTTTTGTTTATGA
AAATAAAGTTGAAAAACAAACAACTGCTTATGGCCAAGATGCAAATGCATATAACGAACCAATGCCAAAT
GCGCGTCCGGCACTCCCCGCTCCAGCTGCATTAACACGTTATGCCGCACAAATGTTTTATGCGCCTTTAC
GTACAGTTGAGCCTTTGGAAGGTGTGCGCCAAGTTTCACATCGCCTTCCTACACCGCTTAAAACGCTCTT
ACCTGCATTGCCTGTGCGAGCTACTCCATTACTCAGCTGGCAACTTGATGGGTATGTTGTCACTGCGGTT
CGCTTGCAAAACCAGGGGCAATCTCGCATTGATTTAGATCCTCGAGAATTGCAAGGGCGATTTTATGCAG
CAACATTTCAGCATAATTGGCTTGGGGGGCATGGTACACCTGAAGATACCACAACGTTATATCTTGTGAC
AGAAGGTTCACCTAATCATTCTGTTATCCCTCAGTCAAATTCATATAAACCGAAAAAATTGAAAAAAGTC
ACCACAACAGTGACAACTCAAACGAAATAA
 Primer design