SecReT4
Protein ID: 345429764
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11880
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1186682..1187326 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDE1W4K1
KEGG IDhpr:PARA_11880
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 5.5e-86, Aligned region: 8..203
Protein Sequence: 214 a.a.     [Download]
>gi|345429764|ref|YP_004822882.1| hypothetical protein PARA_11880 [Haemophilus parainfluenzae T3T1]
MSNLKGIVHQKNREIMTGRIAIGALLVICLVLCAIIFTAPSRLMIYNPPDLRAGSQRPWWEVPKSTVYAF
AYQTFQQLNRWMENGEEEYKLNIERNKAFITPSCQEFLKKDYYDRLSNGELRERARGVYEIVGRGFKDNS
VIVHSPDSWTVNLDLSVDEYFKDEPVKRVLTRFPVNIVRMETDLQHNPWGLGFNCYSSIPLRLEAKEFKE
GDNQ
 
Nucleotide Sequence: 645 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1187326-1186682 Haemophilus parainfluenzae T3T1, complete genome
ATGAGTAACTTAAAAGGGATTGTTCATCAAAAAAATCGCGAAATCATGACCGGGCGAATTGCTATCGGTG
CATTGCTTGTGATTTGTTTGGTGCTATGTGCCATTATTTTTACCGCACCAAGTCGATTAATGATTTATAA
CCCACCGGATTTACGTGCGGGAAGTCAACGCCCTTGGTGGGAAGTGCCAAAATCAACCGTTTATGCCTTT
GCTTATCAAACCTTCCAGCAGTTAAACCGCTGGATGGAGAATGGCGAGGAAGAATACAAATTAAATATTG
AAAGAAATAAAGCCTTTATTACGCCAAGTTGCCAAGAATTTTTGAAGAAAGACTACTATGACCGTTTATC
TAACGGTGAATTACGTGAACGTGCACGTGGTGTTTATGAAATTGTGGGACGTGGATTTAAAGATAATAGT
GTGATTGTTCATAGCCCTGATAGCTGGACGGTTAATCTTGATTTAAGTGTAGATGAGTATTTCAAAGATG
AACCAGTAAAACGTGTTTTAACCCGCTTCCCGGTCAATATCGTGCGCATGGAAACAGATTTACAACACAA
CCCTTGGGGATTGGGATTTAACTGCTACAGCTCAATTCCATTACGTTTAGAAGCCAAAGAATTTAAAGAA
GGGGATAACCAATAA
 Primer design