SecReT4
Protein ID: 345429765
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11890
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1187338..1187709 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDE1W4K2
KEGG IDhpr:PARA_11890
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.2e-40, Aligned region: 6..121
Protein Sequence: 123 a.a.     [Download]
>gi|345429765|ref|YP_004822883.1| hypothetical protein PARA_11890 [Haemophilus parainfluenzae T3T1]
MSSDKEQTIPFLPTRLNRESSVYGGLSVSEFMLAAAMGFILGAVLGLLCCFALGFDFWLLIPSLAMLFCI
LSVVIGKVIIARLKRGKPEAYLNRMIEVKLDGILGGNRFISRQGTWSIRRVKR
 
Nucleotide Sequence: 372 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1187709-1187338 Haemophilus parainfluenzae T3T1, complete genome
ATGTCAAGTGATAAAGAACAAACGATCCCCTTTCTTCCTACTCGATTAAATCGTGAATCGAGTGTGTATG
GCGGGTTATCTGTAAGTGAATTTATGTTGGCTGCAGCAATGGGATTTATCTTAGGTGCAGTGCTTGGCCT
CCTTTGTTGTTTTGCCTTAGGCTTTGATTTTTGGTTGTTAATTCCGTCTCTTGCCATGTTGTTTTGCATT
CTTTCTGTGGTGATTGGCAAAGTGATTATTGCGCGCCTTAAACGAGGTAAGCCGGAAGCCTACTTGAATC
GAATGATTGAGGTTAAATTAGATGGAATATTAGGGGGGAATCGCTTTATCTCCCGTCAAGGCACTTGGTC
TATTCGCCGAGTTAAAAGATAA
 Primer design