SecReT4
Protein ID: 345429766
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11900
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1187729..1188130 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDE1W4K3
KEGG IDhpr:PARA_11900
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 1.9e-26, Aligned region: 43..131
Protein Sequence: 133 a.a.     [Download]
>gi|345429766|ref|YP_004822884.1| hypothetical protein PARA_11900 [Haemophilus parainfluenzae T3T1]
MKLIKSFFQNVSSRFLAVVTLLWLSVENAFATGGGNGINASKIPDFKIPGVDSNTKDPMEIIYLVAKSLA
TLCAILFAAWSIMTVVKALIKTYNAATDENDKKGWGPFIIALILGFILIFFSLWLVKLAIGLF
 
Nucleotide Sequence: 402 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1188130-1187729 Haemophilus parainfluenzae T3T1, complete genome
ATGAAGTTGATTAAATCCTTCTTTCAGAATGTTTCAAGTCGTTTTCTTGCGGTAGTAACTTTACTTTGGT
TATCCGTTGAAAATGCGTTTGCTACAGGCGGTGGTAATGGTATCAATGCCTCTAAAATCCCTGATTTTAA
AATCCCAGGCGTAGATAGTAATACCAAAGACCCGATGGAAATTATCTATCTTGTTGCTAAATCATTGGCA
ACCTTGTGTGCAATTTTATTTGCAGCATGGTCAATCATGACAGTGGTTAAAGCATTAATTAAAACCTATA
ACGCAGCGACTGACGAAAATGACAAAAAAGGATGGGGCCCATTTATTATCGCTCTTATTCTTGGTTTCAT
TTTAATTTTCTTCAGCCTCTGGTTGGTGAAATTGGCTATCGGTCTGTTTTAA
 Primer design