SecReT4
Protein ID: 345429768
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11920
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1188399..1188749 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDE1W4K5
KEGG IDhpr:PARA_11920
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 4.4e-29, Aligned region: 28..110
Protein Sequence: 116 a.a.     [Download]
>gi|345429768|ref|YP_004822886.1| hypothetical protein PARA_11920 [Haemophilus parainfluenzae T3T1]
MESVSSKEFSVTKNIFSLSLAIGVLFGAISAQATEQEHLAQAIKQLDAAKLSLQRAAASAKVSAKSREYF
DYASAHQDIATVQAGIKQYINPSRAIPRNPKAIRNLKEDYLNLRSQ
 
Nucleotide Sequence: 351 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1188749-1188399 Haemophilus parainfluenzae T3T1, complete genome
TTGGAATCTGTTTCAAGTAAGGAGTTCTCCGTGACTAAAAATATTTTCAGTTTATCTCTAGCAATAGGGG
TATTGTTTGGCGCTATAAGTGCTCAAGCAACAGAGCAAGAGCATTTAGCGCAAGCAATTAAACAGTTGGA
TGCAGCAAAACTCTCATTACAGCGAGCAGCTGCAAGTGCAAAGGTTTCTGCGAAAAGTCGTGAATATTTT
GATTACGCTTCAGCACATCAAGATATTGCTACGGTACAGGCAGGGATTAAGCAATATATTAACCCTTCCC
GGGCAATCCCTAGAAATCCTAAAGCTATTCGTAACTTAAAAGAAGATTATCTCAATCTTCGGAGTCAATA
G
 Primer design