SecReT4
Protein ID: 345429769
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11930
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1188880..1189566 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDE1W4K6
KEGG IDhpr:PARA_11930
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 6.5e-66, Aligned region: 38..225
Protein Sequence: 228 a.a.     [Download]
>gi|345429769|ref|YP_004822887.1| hypothetical protein PARA_11930 [Haemophilus parainfluenzae T3T1]
MAEQQVKKKKKGLFYYINAVLAALLGSLILSIILEWLGIAFLWPEEGHLHSQKMMLTELGWLSDSLTRGL
FYHSPKELAEGLILSLHEWLFVKTGVKDWLANPREHSGVGLWVYHYGRAYIESVIYVFITFVIRLVVIVF
TSPLFLLAAFAGFTEGLMMRDRRKFGAGRESSFLYHHARRLIGPIMLSAWVLYLSIPISIYPNIILVPAA
FLFGLSICVTAASFKKYL
 
Nucleotide Sequence: 687 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1189566-1188880 Haemophilus parainfluenzae T3T1, complete genome
ATGGCAGAACAACAAGTCAAAAAAAAGAAAAAGGGTCTTTTTTACTACATTAATGCGGTATTAGCCGCCT
TATTGGGTTCCCTGATTTTGAGCATTATTCTTGAATGGTTAGGTATTGCATTTTTATGGCCTGAAGAAGG
TCATTTACACAGTCAAAAAATGATGCTAACTGAGCTTGGATGGCTTTCTGATAGTCTAACGAGAGGTCTT
TTCTATCATTCTCCAAAAGAGCTGGCTGAAGGTCTTATTTTGTCATTACATGAATGGCTTTTTGTGAAAA
CAGGTGTAAAAGATTGGTTAGCCAACCCTCGTGAGCATAGTGGCGTAGGTTTGTGGGTGTATCATTATGG
GCGAGCATATATTGAGTCAGTGATTTATGTTTTTATCACCTTTGTTATTCGACTTGTAGTGATTGTTTTT
ACTTCCCCACTCTTTTTGTTAGCCGCATTTGCGGGCTTTACTGAAGGGTTAATGATGCGTGACCGTCGTA
AATTTGGTGCAGGCAGAGAGTCTAGTTTTCTTTATCATCATGCACGTCGATTAATTGGCCCGATTATGTT
GTCGGCATGGGTATTGTATCTTTCTATCCCAATTTCTATTTACCCGAATATAATTTTGGTGCCAGCTGCA
TTTCTATTTGGCCTATCCATCTGTGTAACGGCAGCAAGCTTTAAAAAATACCTTTAA
 Primer design