SecReT4
Protein ID: 345429770
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11940
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1189566..1189892 [-]
Producthypothetical protein
Component typeTfc7
UniProt IDE1W4K7
KEGG IDhpr:PARA_11940
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 108 a.a.     [Download]
>gi|345429770|ref|YP_004822888.1| hypothetical protein PARA_11940 [Haemophilus parainfluenzae T3T1]
MINQPDMNLLDIPDMSVDFNSVTSCSCGLENADELLNYFLPYLEDWNNQRYTTHEFAKKYANKGISLWTA
NDVKKSENGIQAIQIFLDGEVKGYLFFHCKLSPAGTLQ
 
Nucleotide Sequence: 327 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1189892-1189566 Haemophilus parainfluenzae T3T1, complete genome
ATGATTAATCAGCCGGATATGAACTTGCTTGATATTCCGGATATGAGCGTAGATTTCAATTCAGTCACTA
GCTGTTCTTGTGGGCTAGAAAATGCAGATGAATTACTTAATTACTTTTTGCCTTATTTGGAAGATTGGAA
TAATCAGCGTTATACCACACATGAATTTGCGAAAAAGTATGCGAATAAAGGCATCTCACTTTGGACGGCT
AATGATGTAAAAAAATCTGAAAATGGCATCCAGGCAATTCAAATTTTTTTAGACGGTGAAGTAAAAGGTT
ATCTTTTCTTTCACTGTAAATTATCTCCAGCGGGAACATTACAGTAA
 Primer design