SecReT4
Protein ID: 345429771
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11950
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1189885..1192134 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDE1W4K8
KEGG IDhpr:PARA_11950
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 5.2e-18, Aligned region: 503..632
TrwB_AAD_bind [PF10412], Evalue: 2.9e-14, Aligned region: 498..643
AAA_10 [PF12846], Evalue: 1.1e-11, Aligned region: 184..580
DUF87 [PF01935], Evalue: 8.7e-05, Aligned region: 185..228
Protein Sequence: 749 a.a.     [Download]
>gi|345429771|ref|YP_004822889.1| hypothetical protein PARA_11950 [Haemophilus parainfluenzae T3T1]
MSQKHVLEGLLRPPVEFFPAAVHGTCAFVCCGAPWSLALNPLIGYGLGAAFAGMGVMRFRQGMEIVRYHR
NLRRLPHYALTSRQIPVSKKALFLGRGFEWEPKHTQRLYDCFSANGQIYWKNGKWFKAARDYEKVHDNWL
SRLTSMDSPLNPVRPLPPVGGIPVMHGVEPNERDIMLPLGDRGGHTLVFGTTGVGKTRFAEVLVTQDIHR
GKTPEEREVVVFFDPKGDPDMLKRMYAEAKRAGRENEFYVFHLGHPEISARYNPVGRFGRISEVAGRISG
QLSGAGNSAAFKEFAWRFVNIVSRALVEMGKRPDYVQISRFVQNIDALFLDYAKLHFDAIDKKIWPTLAS
VAANLDVKNLPFSMKDRPLIAVINQYILENKIFDPVLEGLSSAVRYDKTYFDKIVASLLPLLEKLTTGKT
AELLSPDYTDIHDERPIFDWESIIRKRGIVYVGLDALSDATVAAAVGNSMFADLVSMAGHIYKFGVDEGL
PDVFKTKSKPPKINLHCDEFNELMGDEFIPLINKGRGAGMQVTAYTQTLSDIEARIGSKAKTGQTTGNFN
TLLMFRVKEPATAEFLTRQLNDVTIYQSMVTSSTTDNSNPDDGKAFTSNTGERISEKMVPMLSPAHITNL
PKGQAFALLEGSTLYKLRMPLPAVDKDDVMPESLQELTAYMRKNYHISPNWWQSAFSDYAPSQDIATAFQ
SMSLNRAPSHAGEEMLFGDVDTPVAEDMEDEDIDQNDDTDEDDFDDTDD
 
Nucleotide Sequence: 2250 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1192134-1189885 Haemophilus parainfluenzae T3T1, complete genome
ATGAGTCAAAAACACGTTTTAGAAGGCTTGCTTAGACCGCCAGTTGAGTTTTTCCCAGCTGCCGTCCATG
GTACTTGTGCTTTTGTTTGTTGCGGTGCGCCTTGGTCGCTCGCATTAAATCCTCTTATTGGATATGGATT
AGGCGCAGCTTTCGCAGGTATGGGAGTTATGCGTTTTCGTCAAGGCATGGAAATTGTACGCTATCACCGC
AATTTACGCAGACTCCCACACTATGCCTTGACCAGTCGTCAAATTCCTGTAAGTAAAAAAGCCTTGTTCT
TAGGGCGAGGCTTTGAATGGGAGCCTAAGCATACGCAACGTCTTTATGACTGCTTCTCTGCAAATGGGCA
AATTTATTGGAAAAATGGAAAGTGGTTTAAAGCCGCTCGTGATTATGAAAAAGTGCATGATAATTGGTTA
TCTCGACTCACTTCAATGGACTCTCCATTAAATCCAGTAAGACCGCTACCGCCAGTTGGCGGTATTCCAG
TAATGCATGGTGTAGAGCCGAATGAACGCGATATTATGCTTCCATTAGGCGACCGTGGCGGTCATACCTT
AGTATTTGGTACGACTGGTGTAGGAAAAACGCGTTTTGCTGAAGTGCTTGTGACACAAGATATACATCGA
GGTAAAACACCTGAAGAGCGTGAAGTGGTTGTCTTTTTCGATCCGAAAGGCGACCCAGATATGTTAAAAC
GAATGTATGCCGAAGCGAAACGTGCGGGGCGTGAAAATGAATTTTATGTATTTCATCTAGGTCATCCTGA
AATATCTGCTCGTTATAACCCGGTTGGTCGATTTGGTCGAATTTCAGAGGTGGCAGGACGTATTTCCGGG
CAATTAAGTGGTGCGGGAAATAGCGCAGCATTTAAAGAGTTTGCGTGGCGTTTTGTGAATATTGTCTCCC
GTGCATTGGTTGAAATGGGAAAACGCCCGGATTATGTGCAAATCTCTCGTTTTGTGCAAAATATTGATGC
GCTTTTCTTAGATTATGCCAAACTTCATTTCGATGCTATAGATAAGAAAATATGGCCAACTTTGGCTTCG
GTTGCGGCTAACTTAGATGTAAAAAACTTACCGTTCTCGATGAAAGATAGACCACTGATTGCTGTTATTA
ACCAATATATTTTAGAGAATAAGATTTTTGACCCTGTACTTGAAGGGTTATCAAGTGCGGTACGTTACGA
TAAAACCTATTTTGATAAAATTGTGGCATCGCTTTTACCGTTACTTGAAAAACTCACAACAGGTAAAACT
GCTGAGCTTCTCTCGCCTGATTACACTGATATTCATGATGAGCGCCCTATCTTTGATTGGGAATCTATTA
TTCGCAAAAGAGGAATTGTCTATGTTGGATTGGATGCATTATCCGATGCGACCGTGGCTGCAGCTGTGGG
TAATAGTATGTTTGCTGATTTAGTATCAATGGCTGGTCATATTTATAAATTTGGTGTAGATGAGGGTTTA
CCGGATGTATTTAAAACTAAAAGTAAACCACCTAAAATCAACCTTCATTGCGATGAATTTAATGAATTAA
TGGGTGATGAATTTATTCCCCTTATCAATAAAGGTCGTGGTGCGGGAATGCAGGTAACAGCCTATACTCA
AACACTTTCAGATATTGAAGCTCGTATTGGAAGTAAAGCGAAAACGGGACAAACAACAGGTAACTTCAAT
ACACTTTTAATGTTCCGGGTAAAAGAGCCGGCCACTGCAGAGTTTTTAACGCGTCAGCTCAACGATGTCA
CAATTTATCAAAGCATGGTGACATCAAGTACGACAGATAACAGCAATCCGGATGATGGCAAGGCGTTTAC
GTCTAATACTGGTGAACGTATTTCTGAAAAAATGGTGCCAATGTTATCGCCAGCACATATTACAAATCTA
CCAAAAGGTCAGGCATTTGCCCTTCTTGAGGGAAGTACGCTTTATAAATTAAGAATGCCTTTACCTGCGG
TTGATAAAGATGATGTGATGCCGGAGTCACTCCAAGAATTAACAGCTTACATGCGTAAAAACTACCATAT
TTCTCCAAATTGGTGGCAATCTGCATTTTCTGATTATGCGCCAAGTCAAGATATAGCAACCGCTTTTCAG
TCAATGTCATTAAATCGAGCACCTTCACACGCAGGAGAAGAAATGCTTTTCGGGGATGTTGATACTCCAG
TTGCTGAAGATATGGAAGATGAAGATATTGATCAGAATGATGATACAGATGAGGATGATTTTGATGACAC
AGATGATTAA
 Primer design