SecReT4
Protein ID: 345429773
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11970
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1192653..1193411 [-]
Producthypothetical protein
Component typeTfc4
UniProt IDE1W4L0
KEGG IDhpr:PARA_11970
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 252 a.a.     [Download]
>gi|345429773|ref|YP_004822891.1| hypothetical protein PARA_11970 [Haemophilus parainfluenzae T3T1]
MATNRLLKIVFSLIGLGVATHSVAFNGFGTDIDGYIKDASNRYQVDEAMLRGLVKIEDGWYGNVSPTGAT
GVGQFTRGTWNWLATTDEGRALGMTLITRYNRDTPFDPRKNNQINTLATALYARWHINQFFERGIKPSHE
NLYLAHNIGIDGLHRALQGRATREDILNMKRNGMKKGMSVQGFLVYQSERFNVSKQIANFQRPSVSPRYQ
IENKPLPANLHWVSPTETAMRWVEPASNQTNQQAIRWQNPTN
 
Nucleotide Sequence: 759 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1193411-1192653 Haemophilus parainfluenzae T3T1, complete genome
ATGGCAACAAATCGTCTATTAAAAATCGTATTTAGCTTAATCGGTCTTGGAGTTGCGACTCACTCCGTTG
CATTTAATGGCTTTGGAACTGATATTGATGGCTATATTAAAGATGCATCTAATCGCTACCAAGTCGATGA
AGCGATGCTACGTGGGTTAGTAAAAATTGAAGATGGGTGGTATGGAAATGTTTCCCCAACCGGGGCAACC
GGTGTGGGGCAATTTACCCGGGGCACTTGGAATTGGCTTGCCACAACAGATGAGGGACGTGCTTTAGGGA
TGACGCTGATCACCCGTTATAATCGAGATACGCCTTTTGACCCGCGCAAAAATAATCAGATAAACACTTT
AGCAACCGCACTTTATGCGAGATGGCATATTAATCAGTTTTTTGAGCGAGGCATAAAACCATCCCATGAA
AATTTATATCTTGCTCATAATATCGGTATAGATGGTTTACATCGAGCGCTACAAGGTAGAGCAACACGTG
AAGATATTCTAAACATGAAGCGCAACGGGATGAAAAAAGGAATGTCGGTACAAGGCTTTCTTGTTTATCA
AAGTGAGCGTTTTAATGTCAGTAAACAAATAGCTAACTTCCAGCGCCCTTCAGTATCACCACGTTATCAA
ATTGAGAATAAACCATTACCAGCCAATTTACATTGGGTTTCTCCAACAGAAACCGCTATGCGTTGGGTTG
AGCCAGCGTCAAATCAAACAAATCAACAAGCTATTCGTTGGCAAAATCCAACCAATTAA
 Primer design