SecReT4
Protein ID: 345429774
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_11980
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1193390..1194130 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDE1W4L1
KEGG IDhpr:PARA_11980
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 246 a.a.     [Download]
>gi|345429774|ref|YP_004822892.1| hypothetical protein PARA_11980 [Haemophilus parainfluenzae T3T1]
MNHVKKISYVAMILGMFSTAVFADVTAANTLATQSLNQQNLVTNKLNQQELLAKSQEWGLTEQEWQRYQE
LNQGARGIWSPGLDPLTSLGVESRNEQERERYARLLAKKMHDRMERELQFQRTYDRVFAEMYPNEQPFKV
EPHISERFGRVIYFTRLENCDKCEANADRVLQYVNDKTPIDIYFVGVKNNDQIYNWAKKHNIDPNKVNRK
LITLNHDNGAWLQYADGKMPAAFQIQQDGQWQQIVY
 
Nucleotide Sequence: 741 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1194130-1193390 Haemophilus parainfluenzae T3T1, complete genome
ATGAATCATGTCAAAAAAATATCCTATGTGGCGATGATATTAGGGATGTTTTCTACTGCTGTATTTGCTG
ATGTCACAGCAGCGAATACGCTGGCTACTCAATCCTTAAACCAGCAAAACTTGGTGACAAATAAATTAAA
TCAACAAGAATTATTAGCGAAATCCCAGGAATGGGGGTTGACTGAACAAGAATGGCAGCGCTATCAAGAG
CTTAATCAAGGTGCTCGTGGTATATGGTCGCCAGGACTTGACCCTTTAACCTCGCTTGGTGTGGAGTCTC
GAAATGAGCAGGAAAGAGAGCGTTATGCTCGACTACTGGCAAAAAAAATGCACGACCGCATGGAGCGAGA
GCTGCAGTTCCAGCGCACTTATGATCGCGTATTTGCTGAAATGTATCCAAATGAGCAACCATTTAAGGTT
GAACCTCATATTTCAGAGCGGTTTGGACGGGTGATTTATTTTACTCGCCTAGAAAATTGTGACAAATGTG
AAGCGAATGCTGATCGTGTACTGCAATATGTGAATGATAAAACGCCTATAGATATTTATTTTGTTGGCGT
GAAGAATAATGACCAAATCTATAATTGGGCGAAAAAACATAACATCGACCCAAATAAAGTGAATAGAAAA
TTAATTACCCTTAATCATGATAATGGAGCCTGGTTACAGTATGCAGATGGCAAAATGCCTGCTGCATTCC
AAATTCAACAGGATGGGCAATGGCAACAAATCGTCTATTAA
 Primer design