SecReT4
Protein ID: 345429775
T4SS name [ID]Tfc [46]
Gene symbolpilL
Locus tagPARA_11990
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1194135..1194761 [-]
Productlipoprotein
Component typeTfc2
UniProt IDE1W4L2
KEGG IDhpr:PARA_11990
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 208 a.a.     [Download]
>gi|345429775|ref|YP_004822893.1| lipoprotein [Haemophilus parainfluenzae T3T1]
MKKILLTTFALVVLSGCAHRQTADEQQALENPSIQQGQHQVLQPEDRIVRPDIYTDYQPERTEVLREGRY
TLINFSPEEGQKYLLDQSVSVNMLGKKKRALTATVEQGLRTTLKDTGLSLCHGFGQNEPTLSTLYSRPLP
KVHYQFGPMALRDALQMLAGPAYEITINDVSRTVCFKLRPAVPERATGEKPKVETTTTTTTTTEIIEE
 
Nucleotide Sequence: 627 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1194761-1194135 Haemophilus parainfluenzae T3T1, complete genome
ATGAAAAAAATTCTATTAACCACGTTTGCATTGGTTGTGCTTTCAGGTTGTGCGCACAGACAAACAGCCG
ATGAACAACAAGCATTAGAAAATCCAAGTATTCAACAAGGTCAACATCAAGTCTTACAACCGGAAGATCG
CATAGTCCGTCCGGATATTTACACAGACTATCAACCTGAACGTACAGAAGTGTTACGTGAAGGTCGTTAT
ACTTTAATTAATTTTTCTCCGGAAGAAGGTCAAAAATATCTTCTTGACCAAAGTGTCTCCGTCAATATGT
TAGGCAAAAAGAAACGTGCCTTGACTGCAACTGTTGAACAAGGATTACGTACTACATTAAAAGATACGGG
CCTTTCACTTTGCCATGGCTTTGGTCAGAATGAACCAACACTTTCTACACTTTATTCCCGTCCATTACCA
AAAGTACATTACCAATTTGGCCCGATGGCTTTACGTGATGCCCTTCAAATGTTAGCGGGGCCAGCTTATG
AAATCACTATCAATGATGTTTCTCGTACCGTTTGTTTTAAATTACGCCCAGCTGTACCGGAACGTGCTAC
AGGGGAAAAGCCGAAAGTAGAAACTACGACAACGACAACAACCACAACGGAAATTATCGAGGAATAA
 Primer design