SecReT4
Protein ID: 345429776
T4SS name [ID]Tfc [46]
Gene symbol-
Locus tagPARA_12000
StrainHaemophilus parainfluenzae T3T1
Repliconchromosome [GenBank: NC_015964] [Browse all T4SS(s) in this replicon]
Location [Strand]1194860..1195624 [-]
Producthypothetical protein
Component typeTfc1
UniProt IDE1W4L3
KEGG IDhpr:PARA_12000
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 2.1e-51, Aligned region: 19..250
Protein Sequence: 254 a.a.     [Download]
>gi|345429776|ref|YP_004822894.1| hypothetical protein PARA_12000 [Haemophilus parainfluenzae T3T1]
MINKTLFNSITMPYLTSSQTECLKWLALITMIIDHIGVAFSNAYPALSWCRVIGRFSYVAFGFIIALNLS
RDKVNFKSYFTWMIATAFLSEISFTLFEPNYDRLNVLFQFLSVIGVIWVYKNRQDLNSWVMFLGLGFFII
LSALSDYGLPGLLYCIGCYLFLQTKDTQYHLITMLTCVLLALFVNHSFIDNFGETIVETVSVVAVVIGTM
IFILHPKGLRQCNLSISRMPKAFFYLFYPVHLTIIVGIKYIFIS
 
Nucleotide Sequence: 765 bp     [Download]
>gi|345428590|ref|NC_015964.1|:c1195624-1194860 Haemophilus parainfluenzae T3T1, complete genome
ATGATAAATAAAACTCTTTTTAATAGTATAACGATGCCTTATTTAACCTCTTCTCAAACTGAATGCCTAA
AATGGTTAGCACTCATTACAATGATTATTGATCATATTGGCGTGGCTTTTTCAAATGCTTACCCGGCCCT
ATCTTGGTGTCGGGTGATAGGGCGATTTTCCTACGTGGCGTTTGGATTTATCATCGCGCTTAATTTATCT
CGAGATAAAGTGAACTTTAAAAGTTATTTCACTTGGATGATAGCAACCGCATTTTTATCTGAAATCAGTT
TTACGCTTTTCGAGCCTAATTATGACCGTTTAAATGTCCTATTTCAGTTCTTATCTGTAATCGGGGTAAT
ATGGGTATATAAAAACCGTCAAGACTTAAATAGCTGGGTCATGTTTTTGGGATTGGGCTTTTTTATTATT
CTTTCCGCACTCTCTGATTATGGTTTACCTGGGCTTTTATATTGCATTGGTTGTTATCTCTTTTTGCAAA
CAAAAGATACTCAATATCATCTTATTACGATGCTAACCTGTGTATTGCTCGCACTTTTCGTCAATCACAG
TTTTATTGATAATTTCGGGGAAACTATTGTTGAAACAGTTAGTGTCGTCGCTGTTGTAATTGGCACAATG
ATATTTATTCTTCACCCTAAAGGCCTTCGTCAATGTAATCTCTCAATCTCTCGTATGCCTAAGGCTTTCT
TTTACCTTTTTTACCCAGTTCATTTAACAATTATTGTTGGAATAAAATATATTTTTATCAGCTAA
 Primer design