SecReT4
Protein ID: 34557470
T4SS name [ID]VirB [768]
Gene symbol-
Locus tagWS1091
StrainWolinella succinogenes DSM 1740
Repliconchromosome [GenBank: NC_005090] [Browse all T4SS(s) in this replicon]
Location [Strand]1045289..1047100 [-]
Productconjugal transfer protein (traG)
Component typeVirD4
UniProt IDQ7M994
KEGG IDwsu:WS1091
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.3e-61, Aligned region: 135..592
TrwB_AAD_bind [PF10412], Evalue: 5.5e-28, Aligned region: 343..570
TraG-D_C [PF12696], Evalue: 4.3e-21, Aligned region: 445..564
AAA_10 [PF12846], Evalue: 5.3e-09, Aligned region: 170..521
Protein Sequence: 603 a.a.     [Download]
>gi|34557470|ref|NP_907285.1| conjugal transfer protein (traG) [Wolinella succinogenes DSM 1740]
MIFQKLGNHFIIVIFGMSLLLLIVSSIRAFVSSKNRFELATKDILKALFKRLSFVLLGAILAIPLFAISL
SIYFEIPLLDTPIKIQKLIESIDSTNISKLRNEFWLCVAWALTPLSLALLYLFTPAKSTAYGRARWAEKS
DIQKMGLNCERGFILARAWGKKIKYDTPLSTLVIAPPGTGKTSAIIIPNLLSIPNSQVVIDVKGEICSLT
AGYRQKKLLNQVFIFNPFGEDSNFHFNPFNLERMSKLGFAEKTAIVRQVGSTIFPKPKDEKDSHWRETAK
TFFEFAAMHNIEKYGYTTLYEIYRFPKKDWTDELEDKYFDEKEKREELGEEVNTFRLLLRQIAENETLHD
NIRDDARRFLGTPANEFGSVLSTFSTKMSIFGDLRVKELTDQNSFMPERLREDNITLYIKCLEKDIPSLS
PIIRILLETIVKELMSRESTDPKERIYLELDEVMRFGELDFMIELPSISRSYNLPNIFAAQSYAQIRKHY
SQEDLEIMLDTVAYQVVFRANRQQAAEDISKEVGDFTAHKKTTSSQDIKILQSYSTSEEAKRLVTAQDIL
NIPKDKVLILATGHKATPILAQANFYFKDRTERQKTKIKKENK
 
Nucleotide Sequence: 1812 bp     [Download]
>gi|34556458|ref|NC_005090.1|:c1047100-1045289 Wolinella succinogenes DSM 1740 chromosome, complete genome
ATGATATTTCAAAAACTTGGAAATCATTTCATTATTGTTATTTTTGGAATGTCCCTTCTACTTCTCATCG
TCAGTTCAATTAGAGCTTTTGTAAGCTCAAAAAATCGATTCGAACTTGCAACAAAGGATATACTCAAAGC
ACTATTCAAGCGTCTCTCTTTCGTGCTTCTGGGAGCTATTCTTGCCATTCCCCTTTTTGCAATTTCTCTA
TCGATCTACTTTGAAATCCCTCTTTTGGACACACCTATAAAAATTCAAAAGCTGATCGAAAGTATAGATT
CTACGAATATTTCGAAGCTTCGAAATGAGTTTTGGCTATGTGTTGCATGGGCACTCACTCCTCTATCACT
CGCATTGTTATACTTGTTCACTCCCGCCAAATCGACCGCATATGGTAGAGCAAGATGGGCTGAAAAATCG
GATATTCAAAAGATGGGATTAAACTGTGAGCGAGGATTTATCCTCGCACGGGCGTGGGGTAAAAAGATCA
AATATGACACTCCACTTTCTACACTTGTCATTGCTCCGCCAGGAACAGGAAAAACAAGCGCAATCATCAT
TCCAAATCTTCTATCAATCCCAAACTCTCAAGTTGTGATTGATGTCAAAGGAGAAATATGCTCCCTCACG
GCTGGATACAGACAGAAAAAACTCCTCAATCAAGTATTCATCTTCAATCCCTTTGGAGAGGATTCGAATT
TTCATTTCAATCCATTCAATCTTGAACGAATGTCAAAACTTGGCTTTGCCGAGAAGACAGCAATCGTGCG
ACAAGTTGGAAGCACAATATTTCCAAAACCGAAAGATGAAAAAGATTCACACTGGAGAGAAACGGCGAAA
ACTTTTTTCGAGTTCGCGGCAATGCATAACATCGAAAAATATGGCTACACAACACTTTACGAAATTTATA
GATTTCCAAAGAAAGACTGGACAGACGAGCTTGAAGACAAATATTTTGATGAGAAGGAAAAAAGGGAGGA
ACTTGGTGAGGAGGTGAATACTTTTCGCCTTCTCCTTCGGCAAATTGCCGAGAATGAAACTCTTCATGAC
AATATTCGTGATGATGCAAGACGCTTTCTCGGCACACCGGCAAATGAATTTGGGAGTGTGCTCTCGACAT
TCTCAACGAAAATGAGTATTTTTGGCGATCTGCGCGTGAAAGAGCTCACAGATCAAAATTCATTCATGCC
AGAGAGGCTTCGCGAAGACAATATCACGCTTTACATTAAGTGCTTGGAAAAAGATATCCCCTCCCTCTCT
CCGATCATTCGAATTCTTCTTGAAACAATCGTGAAAGAGCTCATGAGCAGAGAGAGCACAGATCCAAAAG
AGAGAATATATCTCGAGCTTGATGAAGTGATGCGCTTTGGTGAACTTGATTTCATGATTGAGCTTCCAAG
CATTTCAAGAAGCTACAACTTACCAAATATTTTTGCAGCGCAGAGTTATGCGCAGATTCGCAAACACTAT
TCACAAGAGGATCTCGAGATCATGCTTGACACAGTTGCCTATCAGGTCGTTTTTCGCGCAAATCGGCAGC
AAGCAGCAGAAGATATCTCAAAAGAGGTTGGTGATTTCACTGCGCACAAAAAAACAACATCAAGTCAAGA
TATCAAAATCCTTCAAAGCTACAGCACAAGCGAAGAGGCGAAACGACTCGTGACAGCTCAAGATATTCTC
AATATCCCAAAAGATAAAGTTTTGATTCTCGCCACTGGGCATAAAGCAACACCAATTTTAGCGCAGGCTA
ATTTTTATTTTAAAGATCGAACAGAGCGTCAAAAAACAAAAATCAAAAAGGAGAACAAATGA
 Primer design