SecReT4
Protein ID: 34557471
T4SS name [ID]VirB [768]
Gene symbolVIRB11
Locus tagWS1092
StrainWolinella succinogenes DSM 1740
Repliconchromosome [GenBank: NC_005090] [Browse all T4SS(s) in this replicon]
Location [Strand]1047453..1048364 [-]
Producthypothetical protein
Component typeVirB11
UniProt IDQ7MRS0
KEGG IDwsu:WS1092
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.7e-54, Aligned region: 10..286
TrwB_AAD_bind [PF10412], Evalue: 5.6e-05, Aligned region: 135..194
FtsK_SpoIIIE [PF01580], Evalue: 8.4e-05, Aligned region: 133..158
Protein Sequence: 303 a.a.     [Download]
>gi|34557471|ref|NP_907286.1| hypothetical protein WS1092 [Wolinella succinogenes DSM 1740]
MTKVLQNLLKTLEEYLTADGVNEVVINREREVWLDKGGGWHGPIFDARLTTKFLKDFCIELANSREMRFN
EDFCSLSCAIPQTRYRVQALHSVILRDSDIALSIRVPNSNIFPIENFLISPNIKTTHDDLKRLISERKNV
LISGGTGSGKTSFLNALLRFVDRDDRIVTIEDSEELFVENPNRTQILVPKIDTKSMSYELALNSAMRLRP
DRILLGEIDTKNTMTYLRLSNTGHSGMLSTLHANSPADAIHAIINNAMFGSQPVAESIMRGYIKSAIDVI
IQIKREGKSRIISDILNLKEALS
 
Nucleotide Sequence: 912 bp     [Download]
>gi|34556458|ref|NC_005090.1|:c1048364-1047453 Wolinella succinogenes DSM 1740 chromosome, complete genome
ATGACGAAAGTTCTCCAAAACCTCCTCAAAACACTAGAAGAGTATCTCACAGCAGATGGAGTGAACGAAG
TTGTCATCAATAGAGAGCGAGAGGTTTGGCTTGACAAAGGTGGGGGTTGGCATGGGCCCATTTTTGACGC
TCGTCTCACGACAAAATTTCTGAAAGATTTTTGTATCGAGCTCGCAAACAGTAGAGAGATGAGATTCAAT
GAAGACTTTTGCTCTCTATCCTGCGCAATTCCTCAAACACGCTACCGAGTGCAAGCTTTGCACTCGGTCA
TACTTCGGGATAGTGATATTGCGCTTTCAATTCGTGTACCAAACTCAAATATTTTCCCTATTGAAAATTT
TCTGATTTCTCCAAACATCAAAACAACTCACGATGATCTCAAGCGTCTCATTTCAGAAAGAAAAAATGTA
TTGATAAGTGGTGGAACGGGTAGTGGAAAAACATCTTTTCTCAATGCACTTTTGCGGTTTGTTGACCGTG
ACGACAGAATTGTCACGATAGAAGACAGCGAAGAACTTTTTGTTGAAAATCCAAATCGAACACAAATTCT
TGTCCCAAAAATTGATACAAAAAGTATGAGCTATGAACTTGCACTCAATAGTGCGATGAGACTTCGACCA
GACAGAATTCTGCTTGGAGAAATAGACACAAAAAACACAATGACCTACCTAAGACTATCAAATACAGGTC
ACTCTGGTATGCTCTCCACTCTTCATGCAAACTCCCCAGCAGATGCGATTCATGCAATCATCAATAACGC
GATGTTTGGATCTCAGCCAGTCGCAGAATCAATCATGAGGGGATATATCAAATCAGCGATCGATGTGATC
ATTCAAATTAAAAGGGAGGGGAAATCTCGAATCATTTCAGACATACTCAATCTCAAAGAAGCGCTCTCAT
GA
 Primer design