SecReT4
Protein ID: 34557475
T4SS name [ID]VirB [768]
Gene symbolCOMB1
Locus tagWS1096
StrainWolinella succinogenes DSM 1740
Repliconchromosome [GenBank: NC_005090] [Browse all T4SS(s) in this replicon]
Location [Strand]1052623..1053267 [-]
Producthypothetical protein
Component typeVirB8
UniProt IDQ7MRR6
KEGG IDwsu:WS1096
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.3e-29, Aligned region: 23..207
Protein Sequence: 214 a.a.     [Download]
>gi|34557475|ref|NP_907290.1| hypothetical protein WS1096 [Wolinella succinogenes DSM 1740]
MYEKVRVATSLHRLKRRLIDYLLLACIAELLVIVVLITAIITLFPLKEKEPYLVHFSNAEQNFVTLERAG
AELRSDKAVLTALMATYVRNREMIDRMTEKERFEEVRLQSSAKVWRSFETLVNTENSIYAQKKLKREIRL
VNISFLRVGISTVDFIAKTTNGENGSTISEERYRAVLSYGFADTKLRFDEKNMNPTGFLVNDYGVTQINI
GDAL
 
Nucleotide Sequence: 645 bp     [Download]
>gi|34556458|ref|NC_005090.1|:c1053267-1052623 Wolinella succinogenes DSM 1740 chromosome, complete genome
GTGTATGAAAAAGTGCGAGTAGCGACATCGCTACATCGTCTGAAGCGACGATTGATCGACTATCTCCTGC
TGGCTTGTATCGCAGAGCTCCTCGTGATAGTTGTGCTCATCACCGCAATCATCACTCTTTTTCCTCTAAA
GGAAAAAGAGCCGTATCTCGTCCATTTCTCGAACGCTGAACAAAACTTTGTCACTCTTGAGCGAGCTGGG
GCTGAACTGCGTAGTGATAAAGCGGTTCTGACAGCACTGATGGCAACATATGTGCGAAACAGAGAGATGA
TCGATCGCATGACAGAGAAAGAGCGTTTCGAAGAAGTGAGACTTCAATCAAGTGCAAAGGTGTGGCGAAG
CTTTGAGACACTTGTGAATACCGAGAATTCAATATACGCGCAAAAAAAGCTCAAAAGGGAAATAAGATTG
GTGAACATCTCTTTTTTGCGCGTAGGAATCTCGACTGTAGATTTCATTGCAAAAACAACAAATGGCGAGA
ACGGCTCAACGATCTCGGAGGAGAGATATAGAGCGGTCCTTTCTTATGGTTTTGCAGATACAAAACTTCG
CTTTGATGAAAAAAACATGAATCCAACAGGATTTCTTGTCAATGACTACGGTGTGACACAAATCAACATA
GGAGATGCACTATGA
 Primer design