SecReT4
Protein ID: 346643173
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_6232
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5431416..5431784 [+]
Productconjugative transfer region protein
Component typeTfc11
UniProt IDF9XXE4
KEGG IDpfl:PFL_6232
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 2.9e-41, Aligned region: 8..122
Protein Sequence: 122 a.a.     [Download]
>gi|346643173|ref|YP_004842368.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MADDNHDDRTLQFLPNNLNRQPVIMGGLTADEMWATISVSGAVGFVLGVPASILFGNWSLIIAGALVGGV
LGLSVASRIIRRMKRGRPDTWFYRHIQVAIAHLPFGNSSLITRSGAWSCRRD
 
Nucleotide Sequence: 369 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5431416-5431784 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGGCTGACGACAACCACGACGACAGAACCCTCCAGTTCCTACCCAATAACCTGAACCGACAGCCCGTAA
TCATGGGGGGACTTACCGCAGACGAGATGTGGGCAACGATTTCCGTCAGCGGTGCCGTTGGGTTTGTCCT
TGGTGTGCCGGCGTCGATCCTCTTCGGAAACTGGTCACTGATCATTGCTGGAGCATTGGTCGGGGGAGTG
CTCGGGTTGTCCGTCGCAAGCAGGATCATTCGCCGCATGAAACGTGGACGCCCAGACACTTGGTTTTATC
GCCACATACAAGTGGCCATTGCTCACCTTCCGTTCGGCAACAGCAGCCTGATCACGCGATCAGGTGCATG
GTCCTGCCGCCGTGACTAA
 Primer design