SecReT4
Protein ID: 346643175
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4711
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5443072..5444424 [+]
Productintegrating conjugative element protein
Component typeTfc22
UniProt IDQ4K7I9
KEGG IDpfl:PFL_4711
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 450 a.a.     [Download]
>gi|346643175|ref|YP_261794.2| unnamed protein product [Pseudomonas fluorescens Pf-5]
MKKMIQAIGLAISLSGTALAADPIKVESQGSVIGDDVLYSIGGGSAVSMGSAGQMESITVGAGWQNNLIC
GNMDLSHTLENQLNGATQGFQNIMSNVIQSATGAVMSLPALILQRANPALYNLLTNGILQARLDYDRSKG
TCRAMAERMADIAGSQAGWGKVAEGQKMGQALSTGNDAVAVVDKVENGPGNSGVTWVGGEQAGGSGQKPI
KVVSDVVKAGYNLLNGRSATETSRVQQSNCSNGLVCGYWESPTEAAQFANRVLGEQEIKTCEGCSSASTP
GVGLTPLIQETYDKKLTAIQDLLKPGTHITSEKLREASSDSLPITRGVINALRDERDQAVLAQRLASEVA
LSDILGKALMLNRMLITGSRESNVAANNLAVQQTTTQSDVLQKEIDNLKMELDLRRDLANNSPMAIIERG
KTRAENSRTIYQAAPESDRLQLLQKPTGRE
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5443072-5444424 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGAAGAAGATGATCCAGGCTATCGGATTAGCCATCAGCTTGAGCGGTACCGCTTTAGCGGCTGACCCAA
TCAAGGTTGAGTCTCAGGGCAGTGTGATTGGTGACGACGTGCTTTACAGCATCGGCGGGGGGAGTGCTGT
AAGCATGGGCAGCGCCGGGCAAATGGAAAGCATTACCGTTGGAGCGGGATGGCAGAACAACCTGATCTGC
GGAAACATGGATTTGAGCCATACCCTGGAGAACCAGCTGAACGGGGCCACACAGGGCTTTCAAAACATCA
TGAGCAACGTCATCCAGAGCGCTACAGGCGCGGTGATGTCGCTGCCGGCATTGATTCTGCAAAGAGCAAA
CCCTGCACTGTATAACCTGCTGACTAACGGCATCCTGCAGGCGCGCCTCGACTACGATCGATCGAAGGGC
ACCTGCAGGGCAATGGCCGAACGCATGGCCGACATCGCCGGTAGCCAGGCCGGCTGGGGGAAGGTCGCAG
AAGGACAAAAAATGGGACAGGCATTGTCCACAGGAAATGACGCTGTTGCAGTAGTCGATAAAGTTGAGAA
CGGCCCAGGTAACTCCGGGGTTACATGGGTTGGGGGTGAGCAAGCAGGTGGCTCAGGACAAAAACCCATC
AAGGTTGTAAGCGACGTCGTCAAAGCTGGCTACAACCTGCTAAACGGCCGATCCGCTACTGAGACCTCCC
GCGTTCAACAATCGAACTGCTCGAACGGCCTGGTTTGCGGTTACTGGGAGTCTCCTACCGAAGCCGCGCA
GTTTGCGAACCGGGTCCTGGGTGAGCAAGAAATCAAAACCTGCGAAGGCTGCTCCAGTGCCTCGACACCC
GGCGTGGGGCTCACGCCACTGATCCAAGAAACCTACGATAAAAAACTGACAGCCATCCAGGATCTGCTGA
AACCTGGTACGCATATCACCTCAGAAAAACTGAGAGAGGCCAGTAGCGACTCTCTGCCAATTACCCGCGG
TGTGATCAATGCACTGCGGGATGAGCGCGATCAAGCAGTGCTGGCACAGCGTTTGGCATCCGAAGTGGCG
CTCTCGGACATTCTGGGCAAAGCGTTGATGTTGAATCGCATGTTGATAACAGGATCTAGAGAATCGAACG
TCGCCGCGAACAATCTGGCCGTGCAACAGACAACCACCCAATCAGACGTTCTGCAGAAGGAAATCGACAA
TCTCAAGATGGAGCTAGATCTTCGGCGCGACTTGGCGAACAACTCACCGATGGCGATCATTGAGCGCGGT
AAGACTCGCGCTGAGAACTCCCGGACGATCTACCAAGCTGCTCCCGAAAGTGATCGCCTGCAACTGCTGC
AGAAACCTACAGGCAGGGAGTAA
 Primer design