SecReT4
Protein ID: 347430620
T4SS name [ID]VirB [26]
Gene symbolvirB8
Locus tagSLG_p_01080
StrainSphingobium sp. SYK-6
Repliconplasmid pSLPG [GenBank: NC_015974] [Browse all T4SS(s) in this replicon]
Location [Strand]102295..102993 [+]
Producttype IV secretory pathway VirB8 component
Component typeVirB8
UniProt IDG2IU21
KEGG IDssy:SLG_p_01080
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.3e-61, Aligned region: 22..229
Protein Sequence: 232 a.a.     [Download]
>gi|347430620|ref|YP_004831228.1| type IV secretory pathway VirB8 component [Sphingobium sp. SYK-6]
MRAADDRSEAVPASGLQRYFRDARSWDQDRIRNALRSTRIAWSIAAIASLLAAASIFAVAALTPLKTVVP
YVIRVNQTTGAVDVQTALTQRPMRYDEAVTKYFLAQYVRTRESWIPAAAEENFRFVTILSQPTEQQRWAR
FYSSNNGASPQNVWGKNAVVQARVRNIAFINDRVANVRFTRTVQTETDIQNSDWIATITFAYANAPMAEG
DRYRNPLGFQVENYRADPEVIR
 
Nucleotide Sequence: 699 bp     [Download]
>gi|347430512|ref|NC_015974.1|:102295-102993 Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence
ATGCGAGCTGCTGATGACCGCTCGGAGGCGGTGCCGGCATCGGGGCTGCAGCGCTATTTCCGGGACGCAC
GAAGCTGGGATCAGGACAGGATCCGGAACGCGCTGCGCTCGACCCGCATCGCTTGGAGCATCGCGGCCAT
CGCCTCACTCCTGGCCGCGGCCTCGATCTTCGCAGTTGCGGCTCTGACGCCTCTCAAGACTGTCGTGCCC
TATGTTATTCGCGTCAACCAGACCACCGGCGCGGTGGATGTCCAGACCGCGCTCACGCAGCGGCCGATGC
GCTACGATGAGGCGGTCACCAAATACTTCCTCGCCCAGTATGTGAGAACCCGCGAAAGCTGGATCCCGGC
AGCGGCCGAAGAAAATTTTCGGTTCGTGACGATCCTCTCGCAGCCGACCGAACAGCAGCGCTGGGCGCGC
TTCTACAGTAGCAACAATGGTGCCAGTCCCCAAAATGTCTGGGGCAAGAACGCAGTTGTGCAGGCGCGCG
TGCGCAACATCGCCTTCATCAACGATCGCGTCGCCAATGTCCGGTTCACGCGGACAGTCCAGACCGAGAC
CGACATCCAGAACAGCGATTGGATCGCCACGATCACGTTCGCCTACGCCAACGCGCCCATGGCGGAAGGC
GATCGCTACCGGAACCCGCTGGGATTCCAGGTCGAAAACTATCGTGCCGATCCGGAGGTGATCCGATGA
 Primer design