SecReT4
Protein ID: 347430623
T4SS name [ID]VirB [26]
Gene symbolvirB11
Locus tagSLG_p_01110
StrainSphingobium sp. SYK-6
Repliconplasmid pSLPG [GenBank: NC_015974] [Browse all T4SS(s) in this replicon]
Location [Strand]105072..106076 [+]
Producttype IV secretory pathway VirB11 component
Component typeVirB11
UniProt IDG2IU24
KEGG IDssy:SLG_p_01110
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 8.3e-73, Aligned region: 12..313
Mg_chelatase [PF01078], Evalue: 3.3e-06, Aligned region: 153..194
AAA_29 [PF13555], Evalue: 2.3e-05, Aligned region: 149..188
Protein Sequence: 334 a.a.     [Download]
>gi|347430623|ref|YP_004831231.1| type IV secretory pathway VirB11 component [Sphingobium sp. SYK-6]
MRDTAVLRHYLEPLLPLLEPDDVTELVINRPGEAGIEDRQGWRWHELPELDSEWLGTLAVAAASFTHQDI
DGQTPICSTVLPGGERCQIVIPSVTPSGCPSFTIRKPSTVTLPIDQLARAGLFDTTRASARDLTETDAEL
VALRDAGDWPAFFKVAVAARKNILVSGATGSGKTTLAKALIQLIPPDERLLTIEDTRELIVPHRNVVHMV
YSGEGQGRAKVGPKQLLESALRMRPDRILLQELRDGTAFFYLRNVNSGHPGSITTVHAGSAAGAFEQLTL
LVKESEGGRDLARDDIRGLLRMLIDVVVQTRRHGGRFEVEEVYFHPKVGDAGAA
 
Nucleotide Sequence: 1005 bp     [Download]
>gi|347430512|ref|NC_015974.1|:105072-106076 Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence
ATGCGCGATACCGCCGTCCTCCGCCATTATCTCGAACCGCTTCTTCCGTTGCTGGAGCCGGATGATGTAA
CCGAGCTCGTCATCAACCGCCCGGGCGAGGCGGGGATCGAGGACCGGCAGGGGTGGCGATGGCATGAGTT
GCCTGAACTGGACAGCGAGTGGCTTGGAACGCTCGCCGTCGCCGCGGCAAGCTTCACGCACCAGGACATC
GATGGGCAGACGCCGATCTGTTCGACCGTCCTCCCAGGCGGCGAGCGCTGCCAGATCGTGATCCCGTCGG
TGACGCCGAGCGGCTGCCCGTCCTTTACGATACGCAAGCCCTCGACCGTAACCCTGCCGATCGACCAGCT
CGCACGCGCTGGCCTCTTTGACACGACGCGCGCGAGCGCCCGGGACCTTACCGAAACCGACGCCGAGTTG
GTGGCACTTCGCGACGCGGGCGACTGGCCAGCCTTTTTCAAGGTCGCGGTCGCCGCGCGCAAGAATATCC
TGGTCAGCGGGGCGACCGGGTCCGGCAAGACGACCTTGGCGAAAGCGCTTATCCAGCTCATCCCGCCCGA
CGAGCGGCTGCTTACGATCGAGGACACGCGCGAACTCATCGTGCCCCATCGCAATGTCGTTCACATGGTC
TATTCGGGCGAAGGGCAGGGCCGTGCGAAGGTCGGTCCCAAGCAGCTGCTCGAGAGCGCGCTGCGCATGC
GCCCGGACCGGATCCTGCTGCAGGAGCTGCGCGACGGCACCGCCTTCTTCTACCTGCGCAACGTCAACTC
GGGGCACCCTGGGTCGATCACCACCGTCCATGCTGGCTCTGCGGCGGGCGCCTTCGAGCAGCTGACATTG
CTCGTCAAGGAATCCGAGGGCGGCCGCGATCTCGCGCGCGATGATATCCGCGGACTTTTGCGAATGCTCA
TCGATGTGGTCGTCCAGACCCGGCGCCATGGCGGTCGCTTTGAGGTCGAAGAGGTCTACTTCCACCCGAA
GGTGGGCGATGCCGGTGCAGCGTAA
 Primer design