SecReT4
Protein ID: 347430624
T4SS name [ID]VirB [26]
Gene symbolvirD4
Locus tagSLG_p_01120
StrainSphingobium sp. SYK-6
Repliconplasmid pSLPG [GenBank: NC_015974] [Browse all T4SS(s) in this replicon]
Location [Strand]106060..108024 [+]
Producttype IV secretory pathway VirD4 component
Component typeVirD4
UniProt IDG2IU25
KEGG IDssy:SLG_p_01120
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2e-102, Aligned region: 111..536
TraG-D_C [PF12696], Evalue: 1.9e-26, Aligned region: 382..503
TrwB_AAD_bind [PF10412], Evalue: 1.1e-23, Aligned region: 173..512
Protein Sequence: 654 a.a.     [Download]
>gi|347430624|ref|YP_004831232.1| type IV secretory pathway VirD4 component [Sphingobium sp. SYK-6]
MPVQRNFWIIGLSVAGGTLLCCAIAVPVALFGMGQIGPNTDITALPAWLWYYRADPLLILWLKRGALAGA
VVVGLLAIGILRRGPALHGTARFAREGEIRREGLRDAAGIVVGRKAGRFLIFGGSEHVLLEAPTRAGKGV
GVVIPNLLTWPDSVIVLDVKRENWGASAGYRARAGQAVHLFDPLDAEGRTARYNPLAHIRRTDDTEVINE
LQKIAGMLFPAPERSDPFWAEAARAAFVGVGALVASNPGLPFTIGEIYRRLTSGDPKSDLPAALQEARRV
GQRLSQACVSAIQDFTSASDNTFSGIKQTITARLNLWLNPMVDTATSESDFDLREVRRRRMSIYLGVSPD
NIDRIAPIYSLFLQQLVDLNTRDLPEGASNVPVLVLLDEFARLGKASVIASGFSYVAGYGLRLVPVIQSR
SQLRAIYGPDVTDEIIANCGLEVVFTPKELKVANELSERLGFFTMNVKSRSRTIHGLLANRSISESDQRR
ALLLPQELMQLPKNELLLLRAGIPPIRGRKIAYYRMPRFTRRVVAPPVPSARPIAAMLSPPTPASARQGA
GTPGLSGAPQQPATSSGETIQEEIVMREMTDAELAGAAKITDDMLVLGDLAELPPPGDEAAAIAFVSAMV
ERALLPSVGQPSTSIIQERTAHVR
 
Nucleotide Sequence: 1965 bp     [Download]
>gi|347430512|ref|NC_015974.1|:106060-108024 Sphingobium sp. SYK-6 plasmid pSLPG, complete sequence
ATGCCGGTGCAGCGTAACTTCTGGATCATCGGCCTGTCCGTTGCCGGCGGCACCTTATTGTGCTGCGCCA
TCGCCGTGCCAGTTGCCCTCTTTGGGATGGGCCAGATCGGCCCGAACACCGACATCACGGCCTTGCCCGC
ATGGTTGTGGTACTATCGGGCGGACCCGCTGCTTATTCTTTGGCTAAAGCGCGGGGCTCTGGCGGGCGCT
GTTGTGGTCGGGCTCCTCGCAATCGGGATTCTGCGCCGCGGGCCGGCATTGCACGGCACCGCCCGGTTTG
CGCGCGAAGGCGAGATCCGGCGGGAGGGCCTTCGCGACGCTGCCGGCATCGTTGTCGGCCGCAAGGCTGG
ACGTTTCCTGATATTCGGCGGGAGCGAGCATGTTCTGCTCGAGGCGCCCACGCGAGCGGGCAAGGGCGTG
GGCGTCGTCATTCCCAATCTGCTGACCTGGCCAGATTCGGTGATCGTGCTCGACGTGAAGCGGGAGAACT
GGGGCGCAAGCGCCGGCTATCGGGCACGGGCCGGCCAAGCAGTGCATCTGTTCGATCCGCTCGACGCGGA
GGGGCGGACGGCGCGGTACAACCCCCTGGCGCACATCAGGCGGACTGATGACACCGAAGTCATCAACGAG
CTGCAGAAGATCGCGGGCATGCTGTTCCCCGCGCCCGAGCGATCCGATCCCTTCTGGGCGGAGGCCGCGC
GAGCGGCCTTTGTCGGCGTCGGCGCCCTGGTCGCATCCAACCCGGGCCTGCCCTTCACCATCGGCGAGAT
ATACCGCCGCCTCACGAGCGGGGATCCCAAGAGCGACCTTCCCGCAGCGCTTCAGGAAGCTCGCAGGGTG
GGCCAGCGCCTCAGCCAAGCTTGCGTGTCCGCGATCCAAGATTTCACCTCGGCCTCGGACAACACCTTTT
CCGGGATCAAGCAGACCATCACCGCACGGCTCAATCTCTGGCTCAACCCCATGGTGGATACCGCCACCTC
GGAGAGCGACTTCGACCTGCGCGAGGTGCGGCGTCGGCGCATGTCGATTTACCTTGGCGTGTCGCCTGAC
AATATCGACCGCATCGCGCCGATCTACAGTCTGTTCCTGCAGCAACTCGTGGATCTCAACACCCGCGACC
TTCCTGAGGGCGCTAGCAATGTCCCGGTCCTGGTCCTGCTCGACGAGTTCGCCAGGCTCGGCAAAGCCTC
GGTGATTGCGAGCGGCTTCTCCTACGTCGCCGGCTATGGCCTGCGCCTGGTTCCGGTCATTCAGAGCCGA
TCCCAGCTTCGCGCAATCTACGGTCCCGATGTCACCGACGAGATCATCGCCAATTGCGGCCTCGAGGTTG
TCTTCACGCCTAAGGAGCTGAAGGTCGCGAACGAACTTTCCGAACGGCTCGGCTTTTTCACGATGAACGT
GAAATCCCGCAGCCGTACCATCCACGGGCTACTGGCGAACCGGAGCATCTCGGAATCTGATCAGCGCCGC
GCGCTCCTGCTGCCGCAAGAGCTCATGCAGCTGCCGAAGAACGAGCTCCTGCTCCTTCGCGCCGGCATCC
CCCCAATTCGAGGGCGCAAGATCGCCTATTACCGGATGCCGCGCTTCACTCGGCGGGTGGTTGCTCCGCC
TGTGCCGTCCGCCCGTCCAATCGCGGCAATGCTTTCCCCACCTACGCCGGCTTCAGCGCGGCAGGGCGCT
GGTACACCCGGTCTGAGCGGCGCCCCACAGCAGCCGGCGACAAGCTCGGGCGAGACCATACAGGAGGAAA
TTGTGATGCGGGAAATGACCGACGCCGAGCTGGCAGGTGCGGCCAAGATCACGGATGACATGCTGGTTCT
GGGCGACCTGGCCGAACTGCCGCCCCCGGGCGACGAGGCCGCCGCGATCGCGTTCGTGTCGGCGATGGTC
GAGCGGGCACTTTTGCCATCGGTCGGGCAGCCATCCACATCCATTATCCAGGAAAGGACAGCCCATGTCC
GCTGA
 Primer design