SecReT4
Protein ID: 347528982
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_25970
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2809032..2810240 [-]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDG2IJA2
KEGG IDssy:SLG_25970
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.4e-56, Aligned region: 216..394
Protein Sequence: 402 a.a.     [Download]
>gi|347528982|ref|YP_004835729.1| conjugal transfer protein TrbI [Sphingobium sp. SYK-6]
MSEAALQPAPKVDPETLVLRARPPRAIRFRRGIIIAIAAIGSASLIAVAWLALKPRIFRHLDAQEELSQP
NARLTSDALRGAPASYGDVPRLGPPLPGDLGRPILEHQQAMAAMAGPIDQQAQQIDAANSERRIAEQKAA
RESDVLVQSRQGSGTVDSLPAVPAAPAPASSADNGKVALDPERDPNAQGRKAEFVSGLDPRGDTNPHPLV
PAPSPYTLSAGSVIAASLITGIRSDLPGLVTAQVTENVYDSATGGILLVPQGARLIGSYDSVVAFGQKRA
LVVWQRIMLPDGSSLRIDNVPATDPSGYAGLQDKVDFHTWQLLKGVALSTLLGVSSELAFSGQSDLVKAL
RMATQDTVSRAGDRITQRNLNIQPTITIRPGAPVRLVVHKDLILAPWHEQGD
 
Nucleotide Sequence: 1209 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2810240-2809032 Sphingobium sp. SYK-6 chromosome, complete genome
ATGAGCGAAGCAGCCCTCCAGCCCGCGCCCAAGGTCGACCCAGAGACGCTGGTCTTGCGCGCCAGGCCGC
CGCGCGCGATCCGGTTCAGGCGCGGCATCATCATCGCCATCGCCGCGATCGGCTCCGCCAGTCTTATTGC
GGTCGCCTGGCTGGCACTGAAGCCGCGCATATTCCGGCACCTCGATGCTCAGGAAGAATTGTCGCAGCCG
AATGCACGTCTGACGAGCGATGCGCTGAGGGGAGCGCCGGCCAGCTATGGCGATGTGCCAAGGCTGGGTC
CGCCGCTGCCGGGCGATCTCGGCAGGCCGATCCTCGAGCATCAGCAGGCCATGGCTGCGATGGCCGGCCC
GATAGATCAGCAGGCGCAGCAGATCGACGCGGCCAACAGCGAGCGCCGGATCGCCGAGCAGAAAGCTGCG
CGGGAATCGGATGTGCTGGTGCAGAGCCGGCAGGGTAGCGGCACAGTCGACAGCCTGCCTGCGGTGCCGG
CCGCCCCCGCGCCGGCCTCCTCGGCGGACAATGGCAAGGTCGCGCTCGATCCCGAGCGCGATCCAAACGC
CCAGGGGCGCAAGGCCGAATTCGTGAGCGGCCTCGATCCGCGCGGTGACACGAATCCGCACCCACTCGTC
CCGGCCCCGTCGCCTTACACATTGTCGGCCGGCAGTGTGATCGCGGCCAGCCTCATAACGGGCATCAGAT
CTGACCTGCCCGGGCTGGTCACCGCCCAGGTGACCGAGAATGTCTATGACAGCGCCACCGGCGGTATTCT
GCTCGTGCCGCAGGGCGCGCGGCTAATCGGCAGCTATGACAGCGTGGTGGCTTTCGGGCAGAAGCGTGCG
CTGGTCGTCTGGCAACGGATCATGCTGCCAGACGGCAGCTCGCTTCGTATCGACAACGTGCCGGCGACCG
ATCCCTCCGGCTATGCCGGATTGCAGGACAAGGTGGATTTTCACACTTGGCAGCTATTGAAAGGCGTCGC
TCTGTCGACCTTGCTCGGCGTCAGTTCCGAGCTGGCCTTCTCCGGTCAGAGCGATCTTGTGAAGGCGCTC
CGCATGGCGACACAGGATACAGTATCGCGCGCCGGCGACCGGATCACCCAGCGCAATCTCAACATCCAGC
CGACTATCACGATCCGGCCCGGCGCGCCCGTGCGCCTGGTCGTTCACAAGGATCTGATCCTGGCGCCCTG
GCATGAACAAGGAGACTGA
 Primer design