SecReT4
Protein ID: 347528983
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_25980
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2810237..2811190 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDG2IJA3
KEGG IDssy:SLG_25980
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.8e-67, Aligned region: 87..306
Protein Sequence: 317 a.a.     [Download]
>gi|347528983|ref|YP_004835730.1| conjugal transfer protein TrbG [Sphingobium sp. SYK-6]
MKYAILATAVLAATAHAQATPPTTVEPQAAAARPPAAPTAIPPAPPVPVAATPPVQHRRARPSAAELRVR
AANAQATQEPAAHAFINAVQIYPYSDGVLYRLFAAPEHVSDIALQPGETIVSIAAGDTARWTVGDTSSGT
GDTKRAHILVKPFAAGLSTNLIITTDRRAYHLQMESTATTAMAALSWTYPQDELIAIRRQQAEAAAARPV
ASGLAVEQLNFSYAITGDNPAWRPLRAFDDGRQTFIEFPASLGTGEAPPLFLVDARGEASLVNYRVQGRF
YVVDRLFDMAELRLGLRHQQIVRIARASDNGRRRRGS
 
Nucleotide Sequence: 954 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2811190-2810237 Sphingobium sp. SYK-6 chromosome, complete genome
ATGAAATATGCGATCCTCGCGACGGCCGTGCTGGCCGCCACCGCCCATGCCCAAGCTACGCCCCCGACGA
CGGTCGAGCCGCAGGCTGCCGCAGCGAGGCCGCCTGCCGCCCCGACAGCGATTCCGCCAGCTCCCCCGGT
GCCGGTGGCAGCGACACCGCCTGTCCAGCATCGGCGGGCGCGACCATCGGCGGCCGAGCTGCGCGTGCGT
GCGGCAAACGCGCAGGCAACGCAGGAACCGGCCGCGCACGCCTTCATCAACGCCGTCCAGATCTACCCCT
ATAGCGACGGCGTGCTCTACCGGCTCTTCGCGGCGCCCGAGCACGTGTCCGACATCGCGCTTCAGCCGGG
GGAGACGATCGTCTCGATCGCCGCGGGAGACACCGCGCGCTGGACGGTCGGCGATACGAGCAGCGGCACC
GGCGACACGAAACGCGCACACATCCTCGTCAAGCCGTTCGCGGCCGGCCTGTCGACCAACCTCATCATCA
CTACGGACCGGCGCGCCTATCATCTGCAAATGGAAAGCACCGCGACGACCGCGATGGCGGCGCTGTCCTG
GACCTATCCGCAGGATGAGCTGATCGCGATCCGGCGCCAGCAGGCCGAAGCTGCGGCCGCCCGGCCGGTC
GCCTCGGGGCTTGCGGTCGAGCAGCTCAATTTCAGCTATGCGATCACCGGCGACAATCCGGCCTGGCGGC
CGCTGCGCGCATTCGACGACGGGCGGCAGACTTTCATCGAGTTCCCGGCGAGCCTGGGCACCGGCGAAGC
GCCGCCGTTGTTCCTCGTCGATGCGAGAGGCGAGGCAAGCCTCGTCAACTACCGCGTCCAGGGCCGTTTC
TATGTGGTCGATCGCCTGTTCGACATGGCCGAGCTGCGGCTGGGGCTCAGGCATCAGCAGATCGTCCGCA
TCGCCCGCGCGAGCGACAACGGCCGGCGTCGGAGGGGATCATGA
 Primer design