SecReT4
Protein ID: 347528984
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_25990
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2811187..2811987 [-]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDG2IJA4
KEGG IDssy:SLG_25990
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.5e-57, Aligned region: 22..225
Protein Sequence: 266 a.a.     [Download]
>gi|347528984|ref|YP_004835731.1| conjugal transfer protein TrbF [Sphingobium sp. SYK-6]
MIFRRPVQRYGRTPEPETPFQRAGQLWDERIGSARVQARNWRLMAFGGLGLAAALSGGLLWQSMQSRVVP
YVVEVDQLGEPRAVSPADATYRPTDPQIAWFLSRFIADVRGRSLDPVLMRQNWLSAYDFVTTRGSVFLGE
YARSANPFAGLGDRTVSVQVTSVVRASDTSFQVKWTETAWERGALAGRSRWTAILTVTVRPPKTADTLRK
NPLGLYVDAIDWSRELETPADRPAPAPPRPPANLPLGSPLDANPDAPAQPQPETRP
 
Nucleotide Sequence: 801 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2811987-2811187 Sphingobium sp. SYK-6 chromosome, complete genome
ATGATCTTCAGGCGTCCGGTCCAGCGTTATGGACGAACCCCCGAACCGGAAACACCGTTTCAGCGTGCCG
GCCAGCTCTGGGACGAAAGGATTGGCTCAGCCCGCGTCCAGGCCCGCAACTGGCGGCTGATGGCATTCGG
CGGGCTGGGCCTCGCTGCCGCGCTGTCCGGCGGCCTGCTGTGGCAGTCGATGCAGAGCCGCGTTGTCCCT
TATGTGGTCGAGGTGGACCAGCTCGGAGAACCCCGCGCTGTCAGTCCGGCGGATGCGACATATCGGCCGA
CTGATCCGCAGATCGCCTGGTTCCTCAGCCGCTTCATCGCGGATGTCCGCGGTCGCTCGCTCGATCCCGT
GCTGATGCGCCAGAATTGGCTGTCAGCCTATGATTTCGTGACGACGCGTGGAAGCGTCTTCCTCGGCGAG
TATGCCCGCTCGGCCAATCCCTTCGCGGGTCTCGGCGACAGGACCGTGTCGGTTCAGGTGACGAGCGTTG
TGCGCGCATCCGACACGAGCTTTCAGGTGAAATGGACCGAGACGGCTTGGGAGCGCGGCGCGCTCGCAGG
CAGGTCGCGCTGGACAGCCATCCTCACCGTGACGGTCAGGCCGCCGAAGACAGCCGACACGCTGAGGAAG
AATCCGCTCGGCCTCTATGTCGATGCGATCGACTGGAGTCGCGAGCTTGAGACGCCGGCCGACCGGCCGG
CCCCGGCACCACCGCGGCCTCCGGCCAATCTGCCACTCGGCTCCCCGCTCGACGCCAACCCTGATGCTCC
CGCGCAGCCCCAACCGGAGACCCGTCCATGA
 Primer design