SecReT4
Protein ID: 347528985
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_26000
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2811993..2813300 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDG2IJA5
KEGG IDssy:SLG_26000
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-51, Aligned region: 37..262
Protein Sequence: 435 a.a.     [Download]
>gi|347528985|ref|YP_004835732.1| conjugal transfer protein TrbL [Sphingobium sp. SYK-6]
MNDLNVIDSFMQAFIRYIDSGFGVLGGDVSFLARTLIAIDITLAGLFWALGGEDNVLGRLIRKVLYIGAF
AFILNSFSTLADIIFRSFAQAGLTAGGGTLTADDLLKPGRLAGIGFSAAWPLLDQASKLTTFTGFFENFL
TIMILLIAWVIVILAFFILAVQMFVTILEFKLTSLAGFILVPFAFWNRTSFLAERVLGNVVSSGIKVMVL
AVIVGIGSSYFTQFTTALQGQEPDIGQAMSLVLASLALFGLGIFGPGIASGLVAGAPQLGAGSAIATTAL
AAGGFAAAGGAGVSAARGFAGAGLGAIRAGTTMGSAASTAWRLGQETSGSNTVGAGLGGLATAARGTAAQ
RLNNAFGVRAAAERGQQAAWATGSTAPASAGATAGGPVSDRPPGWARRLQSTQAARHHRQMAIHALQSGD
RGGHGATPDIKQRED
 
Nucleotide Sequence: 1308 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2813300-2811993 Sphingobium sp. SYK-6 chromosome, complete genome
TTGAACGACCTCAACGTCATCGACAGCTTCATGCAGGCGTTCATCCGCTACATCGACAGCGGGTTCGGTG
TGCTCGGCGGGGATGTCAGCTTCCTTGCCCGCACGCTGATCGCGATCGACATCACCCTGGCTGGCCTGTT
CTGGGCGCTGGGCGGCGAAGACAATGTGCTGGGGCGCCTGATCCGCAAGGTGCTCTATATCGGTGCCTTC
GCGTTCATCCTGAACAGCTTCTCGACGCTCGCCGACATCATCTTCCGCTCGTTCGCGCAGGCCGGGCTCA
CGGCGGGCGGCGGCACGCTGACGGCGGACGATCTCCTGAAACCCGGCCGTCTCGCCGGCATCGGATTTTC
GGCAGCCTGGCCGCTGCTCGATCAGGCATCGAAGCTCACCACCTTCACCGGCTTCTTCGAGAATTTCCTG
ACGATCATGATCCTGCTGATCGCCTGGGTCATCGTCATCCTCGCCTTCTTCATCCTTGCGGTGCAGATGT
TCGTGACGATCCTCGAGTTTAAGCTGACCAGCCTGGCCGGCTTCATCCTCGTGCCGTTCGCCTTCTGGAA
CCGCACCAGCTTCCTCGCCGAACGGGTGCTTGGCAATGTCGTCAGCTCCGGCATCAAGGTGATGGTGCTC
GCCGTCATCGTCGGCATCGGCTCCAGTTATTTCACCCAGTTCACGACCGCGCTGCAGGGTCAGGAACCCG
ACATCGGGCAGGCGATGAGCCTCGTGCTGGCGAGCCTCGCCCTGTTCGGGCTTGGCATTTTCGGCCCCGG
CATCGCGTCCGGCCTGGTCGCAGGCGCCCCACAGCTCGGTGCCGGATCGGCGATCGCCACGACAGCACTG
GCGGCAGGCGGATTCGCCGCCGCTGGTGGTGCCGGTGTCTCCGCGGCGCGGGGTTTCGCGGGCGCGGGCC
TTGGCGCGATCCGCGCCGGCACTACGATGGGATCAGCCGCGTCCACGGCTTGGAGGCTCGGCCAGGAAAC
ATCCGGCTCCAACACGGTCGGTGCTGGTCTGGGCGGCCTCGCCACAGCCGCGCGCGGTACAGCGGCGCAG
CGCCTGAACAATGCTTTCGGCGTTCGCGCCGCTGCCGAACGGGGCCAGCAAGCGGCCTGGGCAACGGGGA
GCACCGCGCCCGCGTCAGCCGGCGCGACCGCAGGCGGGCCGGTATCCGATAGGCCCCCCGGCTGGGCACG
CCGGCTCCAGTCCACGCAGGCCGCCCGTCATCACCGTCAGATGGCGATCCATGCGCTGCAATCCGGCGAC
CGCGGCGGTCATGGCGCCACCCCCGACATCAAGCAAAGGGAGGACTGA
 Primer design