SecReT4
Protein ID: 347528986
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_26010
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2813415..2814158 [-]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDG2IJA6
KEGG IDssy:SLG_26010
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 2.4e-07, Aligned region: 22..53
Protein Sequence: 247 a.a.     [Download]
>gi|347528986|ref|YP_004835733.1| conjugal transfer protein TrbJ [Sphingobium sp. SYK-6]
MRIVPREYLIASALGLGATGALIIAVTTSTPAQAQWTVFDPSNYSQNILTAARTLQQINNQIQMLQNQAQ
SLIYQAKNLTTISFPELQTITQTIQQIDQLMGQAQGIQFRVANLDQQFHQLFPDSLNQAFTTNQQVQSAR
ARMDTAKAAFQQTMTVQSQVVENVQTDAQALAGIVARSQGAQGALQAQQATNQLLALTAKQQFQIQNLMA
AQYRAQAIEQAQRAQSKADGQAATARFLGSGNAYTPQ
 
Nucleotide Sequence: 744 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2814158-2813415 Sphingobium sp. SYK-6 chromosome, complete genome
ATGCGTATCGTCCCACGCGAATATCTGATCGCGTCCGCGCTCGGTCTCGGCGCGACCGGCGCGCTCATCA
TCGCTGTGACCACCAGCACGCCTGCCCAGGCGCAATGGACCGTGTTCGATCCCTCGAACTATAGCCAGAA
TATCCTGACGGCCGCCCGGACGCTGCAGCAGATCAACAACCAGATCCAGATGCTGCAGAACCAGGCGCAG
AGTCTCATCTACCAGGCGAAAAACCTGACGACGATCAGCTTTCCCGAGCTTCAGACGATCACCCAGACAA
TCCAGCAGATCGACCAGCTCATGGGACAGGCGCAGGGCATCCAGTTCCGTGTCGCCAATCTCGACCAGCA
GTTCCACCAGCTTTTCCCCGACAGCTTGAACCAGGCATTCACCACCAACCAGCAGGTGCAGAGTGCCCGC
GCCCGCATGGATACGGCAAAGGCGGCATTCCAGCAGACCATGACGGTCCAGTCGCAGGTTGTCGAGAATG
TGCAGACTGACGCGCAGGCGCTCGCCGGCATCGTCGCGCGCAGCCAGGGCGCACAGGGCGCGCTTCAGGC
GCAACAGGCCACCAACCAGCTTCTGGCGCTCACCGCCAAGCAGCAGTTCCAGATTCAGAACCTGATGGCC
GCGCAATATCGCGCGCAGGCGATCGAGCAGGCGCAGCGTGCGCAGTCCAAGGCGGACGGGCAGGCGGCAA
CCGCCAGGTTCCTCGGTTCCGGTAACGCCTACACCCCCCAATAG
 Primer design