SecReT4
Protein ID: 347528987
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_26020
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2814158..2816605 [-]
Productconjugal transfer protein TrbE
Component typeTrbE
UniProt IDG2IJA7
KEGG IDssy:SLG_26020
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 3e-34, Aligned region: 443..723
CagE_TrbE_VirB [PF03135], Evalue: 1e-15, Aligned region: 177..389
Protein Sequence: 815 a.a.     [Download]
>gi|347528987|ref|YP_004835734.1| conjugal transfer protein TrbE [Sphingobium sp. SYK-6]
MLNLREYRHRADRLADHLPWAGLVADGVVLNKDGSFQRTLAFRGPDLGSATEAELISACARANNVLKRFG
TGWALFFEAERRESQGYPDSAFPDAASWLLDEERRAGFEGEGEHYESRFHLTLVWLPPADSSDAAGRSLV
ERPDAHEGRDWRSVLASFVAETDRALDLFGAFMPEMRALSSAETLTYLHGAISERPHPIAMPDTPIYLDG
LLADTPLIGGLEPMLGLSHIRTLTVTGFPNMSRPGILDALNEAAFPYRWVTRFISLDKADATRVLTRLRR
QWFNKRKSITALLREVMYNQPAQLLDSDADNKVIDADLALQALGGDHVAFGYLTATITVADEDRVRVEDK
VRNVERIINGLGFTTIREGVNAVEAWLSSLPGQTYANVRQPIVHTLNLAHLMPLSSVWAGPARNAHLDGP
PLLVAQTAGSTPFRLSTHVGDVGHMMVVGPTGAGKSVLLALIALQFRRYAASQIYIFDMGRSARAATLAC
GGAHHALGSGDDEGGLAFQPLRAIDDMAERAWASEWIVALLDQQKVVVDPAIKEAVWSALGSLASAPPDE
RTITGLALLLQSNALRSAIASYTLEGPYGRLLDAAESRLALADMQCFETETLMNSTGAVAPVLTYLFHRL
EERFDGRPTLLILDEAWKFLDHPLFAARIREWLKTLRKKNVGVVFASQSLADVAESSIAPAIIESCPQRI
LLPNDRAIEPQARAAYERFGLNDRQIELIARATPKRHYYLQSARGNRLFELGLGPIALALCGASDPATQE
RIDSILAEQGPDQFATHFLASTGLDWAAELLADFTAPHAPKEGVL
 
Nucleotide Sequence: 2448 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2816605-2814158 Sphingobium sp. SYK-6 chromosome, complete genome
ATGCTGAACCTGCGCGAATATCGCCACCGCGCCGACCGTCTGGCCGACCATCTGCCCTGGGCGGGGCTGG
TCGCGGACGGCGTCGTTCTGAACAAGGATGGCAGCTTCCAGCGCACCCTGGCGTTTCGCGGCCCCGACCT
CGGAAGCGCGACCGAAGCGGAGCTGATCTCGGCCTGCGCGCGGGCCAACAATGTCCTCAAACGCTTCGGG
ACCGGGTGGGCGCTGTTCTTCGAGGCGGAACGGCGCGAGAGCCAAGGCTATCCCGATAGCGCCTTTCCCG
ATGCGGCGTCCTGGCTGCTCGATGAGGAACGGCGCGCTGGATTCGAAGGCGAAGGCGAGCATTATGAGAG
CCGCTTCCATCTGACGCTGGTCTGGCTGCCGCCCGCCGATAGCAGCGACGCCGCCGGCCGGTCGCTTGTG
GAGCGTCCCGATGCCCATGAAGGCCGCGACTGGCGCAGCGTGCTCGCATCTTTCGTCGCCGAAACCGATC
GCGCGCTCGACCTGTTCGGCGCCTTCATGCCCGAGATGCGCGCGCTCTCCTCGGCTGAAACGCTGACCTA
TCTGCATGGCGCCATATCGGAGCGGCCGCATCCGATCGCGATGCCCGATACGCCCATCTATCTGGATGGA
CTGTTGGCCGACACGCCGCTCATCGGTGGCCTCGAGCCGATGCTGGGGCTCAGTCATATCCGCACCCTGA
CCGTCACCGGCTTCCCGAATATGAGCCGGCCGGGCATTCTCGACGCGCTCAATGAGGCCGCTTTTCCCTA
TCGCTGGGTGACGCGCTTCATCAGTCTCGACAAGGCCGATGCGACCAGGGTGCTGACCAGGCTCCGGCGG
CAATGGTTCAACAAGCGCAAGTCGATCACCGCGCTGCTGCGCGAGGTGATGTATAACCAGCCGGCGCAGC
TCCTCGACAGCGATGCCGACAACAAGGTGATCGATGCCGATCTCGCGCTGCAGGCTTTGGGCGGCGATCA
TGTCGCGTTCGGCTATCTCACCGCCACGATCACCGTGGCGGATGAGGATCGCGTGCGCGTGGAGGACAAG
GTCCGCAACGTCGAGCGGATCATCAACGGGCTGGGCTTCACCACGATCCGCGAGGGTGTGAACGCGGTCG
AGGCATGGCTGTCGTCGCTCCCCGGCCAGACCTATGCCAATGTCCGCCAGCCCATCGTCCACACGCTGAA
CCTGGCCCATCTCATGCCGCTCTCGTCGGTATGGGCGGGACCGGCGCGCAATGCTCATCTCGACGGGCCG
CCACTGCTCGTGGCGCAGACCGCTGGCTCGACCCCGTTCCGGCTCTCGACCCATGTCGGCGACGTCGGTC
ACATGATGGTCGTTGGGCCGACGGGCGCCGGCAAGTCGGTTCTTCTGGCGCTGATCGCGCTCCAGTTCCG
GCGCTATGCAGCGAGCCAGATCTATATCTTCGACATGGGGCGTTCGGCCCGCGCTGCGACGCTGGCATGC
GGTGGCGCTCACCACGCGCTCGGGTCCGGCGACGACGAGGGCGGTCTGGCCTTCCAGCCACTGCGCGCGA
TCGACGACATGGCGGAACGGGCCTGGGCGTCCGAATGGATCGTGGCTTTGCTCGACCAGCAAAAGGTTGT
GGTCGATCCGGCCATCAAGGAAGCGGTCTGGTCGGCACTTGGCAGCCTGGCGTCGGCCCCGCCCGATGAA
CGGACAATCACCGGCCTGGCCCTCCTGCTTCAGTCCAATGCGCTCCGGTCCGCGATCGCCAGCTATACGC
TCGAAGGCCCTTATGGACGGCTGCTCGATGCGGCGGAAAGCCGGCTCGCGCTTGCCGATATGCAGTGCTT
CGAGACCGAGACGTTGATGAACAGCACGGGCGCGGTGGCGCCGGTGCTGACCTATCTCTTCCACCGCCTG
GAGGAGCGGTTCGACGGACGGCCAACGCTGCTCATCCTCGACGAGGCCTGGAAGTTCCTCGACCATCCGC
TGTTCGCCGCGCGCATCCGCGAATGGCTGAAGACGCTCAGAAAGAAGAATGTCGGTGTCGTCTTCGCCAG
CCAGAGCCTCGCCGACGTGGCCGAAAGCAGCATTGCCCCGGCCATCATCGAGAGTTGCCCGCAGCGTATC
CTGCTGCCCAATGATCGCGCGATCGAGCCGCAGGCGCGCGCCGCCTATGAGCGGTTCGGTCTCAACGACC
GCCAGATCGAACTGATCGCCCGCGCCACGCCGAAGCGGCACTATTATCTGCAATCGGCGCGGGGCAATCG
GCTGTTCGAGCTGGGATTGGGACCGATTGCGCTGGCGCTGTGCGGTGCGTCCGATCCCGCCACGCAGGAG
CGGATCGACAGCATCCTGGCCGAGCAAGGGCCGGATCAGTTCGCGACCCACTTCCTCGCTTCCACTGGCC
TCGACTGGGCCGCTGAGCTGCTCGCTGACTTTACCGCCCCCCATGCCCCCAAAGAAGGAGTCCTGTAA
 Primer design