SecReT4
Protein ID: 347528988
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_26030
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2816599..2816883 [-]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDG2IJA8
KEGG IDssy:SLG_26030
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 2.5e-09, Aligned region: 17..91
Protein Sequence: 94 a.a.     [Download]
>gi|347528988|ref|YP_004835735.1| conjugal transfer protein TrbD [Sphingobium sp. SYK-6]
MPASPHIAGAHIEGFEAPIHGALGSPILLGGAPRMIAIVNGTIAAAIGLGLQQWVAGLVLWAAGHSLAVF
AARRDPDFAPVLIRHLRQRSHFTC
 
Nucleotide Sequence: 285 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2816883-2816599 Sphingobium sp. SYK-6 chromosome, complete genome
ATGCCAGCTTCGCCGCATATCGCCGGGGCCCACATCGAGGGCTTCGAGGCGCCAATTCACGGCGCCCTGG
GCTCGCCGATCCTGCTGGGCGGCGCACCGCGGATGATCGCGATCGTGAACGGCACGATCGCGGCCGCGAT
CGGTCTCGGTCTCCAGCAATGGGTGGCGGGGCTGGTGCTGTGGGCGGCCGGACACAGCCTTGCCGTGTTC
GCCGCCCGCCGTGACCCCGATTTCGCGCCAGTCCTCATCCGCCATCTCAGGCAGAGGAGCCATTTCACAT
GCTGA
 Primer design