SecReT4
Protein ID: 347528989
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_26040
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2816892..2817227 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDG2IJS1
KEGG IDssy:SLG_26040
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 5.3e-25, Aligned region: 8..100
Protein Sequence: 111 a.a.     [Download]
>gi|347528989|ref|YP_004835736.1| conjugal transfer protein TrbC [Sphingobium sp. SYK-6]
MRTLKIPDRRSTFLVGAVIGLTLTIKTRAFASGTGMPWEQPLQQILDSVQGPVAKIVAVIIIIVTGLTLA
FGETSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALIA
 
Nucleotide Sequence: 336 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2817227-2816892 Sphingobium sp. SYK-6 chromosome, complete genome
ATGCGCACTTTGAAGATTCCTGATCGCCGTTCCACCTTCCTCGTCGGTGCCGTGATCGGCCTGACGCTGA
CCATAAAGACCCGCGCCTTTGCGTCCGGCACCGGAATGCCGTGGGAGCAACCGCTCCAGCAGATTCTGGA
TTCGGTGCAAGGGCCGGTCGCCAAGATCGTCGCGGTGATCATCATCATCGTCACCGGCCTGACGCTCGCG
TTCGGCGAGACCAGCGGTGGCTTCCGGCGCCTGATCCAGATCGTATTCGGTCTGTCGATCGCCTTTGCCG
CGTCGAGCTTTTTCCTGTCCTTCTTCTCGTTTGGCGGCGGGGCGCTGATTGCGTGA
 Primer design