SecReT4
Protein ID: 347528990
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_26050
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2817229..2818218 [-]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDG2IJS2
KEGG IDssy:SLG_26050
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 9.8e-88, Aligned region: 22..293
Zeta_toxin [PF06414], Evalue: 3.3e-05, Aligned region: 151..217
Protein Sequence: 329 a.a.     [Download]
>gi|347528990|ref|YP_004835737.1| conjugal transfer protein TrbB [Sphingobium sp. SYK-6]
MTAASALSVDRRRAMLRTAMGSAIAAALGDPRVVEVMVNPDGALRVDILGEGRVDTDVRLDPAQVERIIR
LVASHARSEVHGERPIVSAELPPHGDGAGERFEGLLPPVSTAPCFSIRKPAARIYTLLDYVRDGIMPAES
ARLLSRAVVDRRNILVVGGTSSGKTTLANALLSEMAHLDERVILIEDTRELQCAAPDVVALRTRAGSVTM
ADLVRSTLRLRPDRIIVGEVRGPEALDMLKAWSTGHPGGIATVHANSAASALYRIEQLVQEAVVTVPRRL
IAEAIDLIVFIAGRGLARRIETIARVAGLDPDGAYAVLDITPAIQPQGE
 
Nucleotide Sequence: 990 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2818218-2817229 Sphingobium sp. SYK-6 chromosome, complete genome
ATGACCGCGGCATCCGCTTTGTCCGTCGACCGGCGTCGCGCGATGCTGCGCACGGCGATGGGGTCAGCCA
TCGCCGCCGCCCTTGGAGATCCCCGCGTGGTCGAGGTGATGGTCAATCCCGACGGCGCGCTGCGTGTTGA
TATTCTCGGCGAAGGTCGGGTCGATACGGACGTGCGGCTCGATCCCGCGCAGGTCGAGCGGATCATCCGG
CTCGTTGCCAGCCATGCCCGCAGCGAGGTGCATGGCGAACGGCCGATCGTCTCGGCCGAGCTGCCGCCGC
ACGGTGACGGCGCCGGTGAGCGGTTCGAAGGATTGCTGCCGCCGGTATCGACCGCGCCCTGCTTCTCGAT
CCGCAAGCCTGCCGCGCGCATCTACACGCTGCTCGATTATGTGCGCGACGGCATCATGCCGGCGGAATCC
GCCCGGCTGCTGTCCCGCGCCGTCGTCGATCGCAGGAACATCCTCGTCGTCGGCGGCACGTCCTCGGGCA
AGACGACACTCGCCAATGCGCTCTTATCGGAGATGGCGCATCTCGACGAGCGGGTCATCCTGATCGAGGA
TACGCGCGAGCTGCAATGCGCGGCGCCCGATGTGGTGGCGCTACGTACCCGTGCCGGCTCGGTGACGATG
GCCGACCTTGTCCGCTCGACGCTCCGGCTGCGGCCGGATCGCATCATCGTCGGCGAGGTTCGCGGTCCCG
AAGCCCTCGACATGCTGAAAGCTTGGAGCACCGGGCATCCCGGCGGGATCGCCACCGTCCATGCCAACAG
CGCCGCCTCCGCCCTCTATCGGATCGAACAGCTCGTGCAGGAGGCGGTGGTCACCGTGCCGCGCCGGCTG
ATCGCCGAGGCGATCGACCTGATCGTGTTCATCGCCGGGCGTGGCCTGGCCCGCCGCATTGAGACGATTG
CCCGCGTCGCCGGCCTCGATCCCGACGGTGCCTACGCCGTTCTCGACATCACCCCTGCCATCCAACCCCA
AGGAGAATGA
 Primer design