SecReT4
Protein ID: 347528992
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_26070
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2818623..2820644 [-]
Productconjugal transfer protein TraG
Component typeTraG
UniProt IDG2IJS4
KEGG IDssy:SLG_26070
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.1e-104, Aligned region: 113..562
TrwB_AAD_bind [PF10412], Evalue: 1.9e-31, Aligned region: 146..542
TraG-D_C [PF12696], Evalue: 1.6e-30, Aligned region: 408..528
AAA_10 [PF12846], Evalue: 3.8e-08, Aligned region: 199..484
Protein Sequence: 673 a.a.     [Download]
>gi|347528992|ref|YP_004835739.1| conjugal transfer protein TraG [Sphingobium sp. SYK-6]
MTPTKLLIGQIVIVFAIVVAGVWASTQWCAAMLGYQPQLGAAWFVIDGMPIYRPWAIFLWWYHYDAYAPH
VFDKAGTLAGASGFLGCGAAIAGSLWRARQSRNVTTYGSARWARAGEIARAGLHRDAGVFLGRLDGHYLR
HNGPEHVMAFAPTRSGKGVGLVVPTLLSWAGSAVIHDIKGENWQLTAGWRSRFSHVLLFNPTDPRSAKYN
PLLEVRRGENEVRDVQNIADILVDPEGALERRSHWEKTSHSLLVGAILHILYAEGEKTLARVATFLSDPQ
RPFTATLRQMMTTNHLGSKDAPRVHPVVASAAREVLNKSDNERSGVLSTAISFLGLYRDPTIAEVTSRCD
WRIADLVEAPQPVSLYLVIPPSDISRTKPLVRLVLNQIGRRLTEKLDADRNRSRKHQLLMMLDEFPALGR
LDFFETSLAFLAGYGVRVFLIAQSLNQVDKAYGEHNSILDNCHVRVAFATNDERTAKRISDALGQATEQR
AMRNYAGHRLAPWLAHVMVSRQETARPLLTQGEVMQLPPAEELVLIAGLAPIRAKKLRYYEDRNFRTRLA
PPPELTRGAYVDRPQARPDDWAGIVRTPDARLGAASDEAGAAEDEGGLQQQRHPGIEEKTDRTGTERQSD
LPETERDDTDAAVDKRVMDRARASLVRGHAINQGQAQDLLPGF
 
Nucleotide Sequence: 2022 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2820644-2818623 Sphingobium sp. SYK-6 chromosome, complete genome
ATGACCCCAACCAAGCTGCTGATCGGCCAGATTGTCATCGTCTTCGCGATCGTCGTCGCCGGCGTCTGGG
CATCGACGCAATGGTGCGCGGCGATGCTCGGCTACCAGCCGCAGCTCGGCGCTGCCTGGTTCGTGATCGA
CGGCATGCCGATCTATCGGCCCTGGGCAATCTTCCTCTGGTGGTATCACTACGATGCCTATGCGCCGCAT
GTCTTCGACAAGGCCGGCACGCTTGCCGGCGCCAGCGGCTTCCTGGGCTGCGGCGCCGCGATCGCCGGTT
CGCTCTGGCGGGCTCGCCAGTCGCGCAACGTCACCACCTACGGCTCCGCGCGCTGGGCAAGAGCCGGCGA
GATTGCGCGTGCCGGCCTGCACCGTGATGCCGGCGTCTTCCTCGGGCGCCTGGATGGTCACTATCTTCGT
CATAACGGGCCGGAGCATGTCATGGCCTTCGCGCCGACGAGGAGCGGCAAAGGTGTCGGCCTTGTTGTTC
CGACGCTGCTGAGCTGGGCCGGCTCGGCGGTCATCCACGACATCAAGGGCGAGAACTGGCAGCTCACCGC
CGGCTGGCGGTCGCGCTTCAGCCATGTGCTGCTGTTCAATCCCACCGACCCGCGCTCGGCCAAATATAAT
CCCCTGCTCGAGGTCCGCCGCGGCGAGAACGAGGTCCGCGACGTCCAGAACATCGCCGACATTCTCGTCG
ATCCGGAAGGCGCGCTCGAGCGTCGTTCGCATTGGGAGAAGACGAGCCATTCGCTACTGGTCGGCGCGAT
CCTCCACATCCTCTATGCCGAAGGAGAGAAGACGCTCGCCCGCGTCGCCACCTTCCTGTCAGATCCCCAG
CGCCCGTTTACCGCCACGCTCCGGCAGATGATGACCACCAATCATCTCGGCAGCAAGGATGCCCCGAGGG
TACATCCCGTCGTCGCATCGGCCGCGCGCGAGGTGCTCAACAAGTCCGACAACGAGCGCAGCGGCGTGCT
GTCGACCGCCATCTCGTTCCTCGGGCTGTACCGCGATCCGACCATAGCCGAGGTCACGTCGCGCTGCGAC
TGGCGGATCGCCGATCTCGTCGAGGCGCCGCAACCGGTGTCGCTCTATCTGGTCATCCCGCCATCCGACA
TCAGCCGCACCAAACCGCTGGTCCGGCTGGTGCTCAACCAGATTGGCCGCCGCCTGACCGAGAAACTGGA
CGCCGACCGCAACCGGAGCCGCAAGCACCAGCTTCTGATGATGCTCGACGAGTTCCCGGCGCTGGGGCGG
CTCGACTTTTTCGAGACCAGTCTCGCGTTTCTCGCTGGCTATGGTGTCCGCGTTTTCCTGATCGCGCAGT
CCCTGAATCAGGTGGACAAAGCCTATGGCGAGCACAATTCCATCCTCGACAATTGCCACGTCCGCGTCGC
CTTCGCGACCAATGACGAGCGCACAGCCAAGCGGATTTCCGATGCGCTGGGACAGGCGACCGAGCAGCGC
GCGATGCGTAACTATGCCGGGCACCGGCTCGCGCCCTGGCTCGCGCACGTCATGGTCAGCCGGCAGGAGA
CCGCCCGGCCGCTCCTGACCCAGGGCGAGGTCATGCAGCTTCCGCCGGCCGAAGAGTTGGTGCTGATTGC
GGGCCTGGCACCGATCCGCGCGAAGAAGCTGCGCTATTATGAAGATCGCAACTTCCGAACACGTCTCGCC
CCGCCGCCCGAACTGACCCGTGGCGCCTATGTCGACCGGCCGCAGGCCCGTCCCGACGATTGGGCTGGTA
TCGTCCGCACGCCGGATGCGCGGCTCGGGGCTGCCAGTGACGAGGCCGGTGCGGCCGAGGACGAAGGCGG
CCTCCAGCAGCAGCGCCACCCCGGTATTGAGGAGAAAACAGACCGGACCGGGACGGAGAGGCAGTCCGAT
CTTCCCGAGACCGAGCGTGACGACACGGACGCCGCCGTCGACAAGCGCGTGATGGATCGCGCCCGTGCCT
CGCTGGTGCGCGGCCATGCGATAAACCAGGGGCAGGCCCAGGACCTGCTGCCAGGGTTCTGA
 Primer design