SecReT4
Protein ID: 347528999
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_26140
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2825464..2826090 [-]
Productputative lytic transglycosylase
Component typeTrbN
UniProt IDG2IJT1
KEGG IDssy:SLG_26140
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 208 a.a.     [Download]
>gi|347528999|ref|YP_004835746.1| putative lytic transglycosylase [Sphingobium sp. SYK-6]
MAALKTIAVALALLVAAPASARVAEDPVSRWQPIIAEASQRFGLPEAWIIAVMRAESRGRTTLDGQPITS
RAGAMGLMQLMPGTYAEMRGRLGLGPDPHDPRDNILAGAAYLRLMHDRFGYPGLFGAYNAGPTRYAEHLR
TGRPLPGETRAYLAVLARMPFSPAMPPGILSGDRLFFSAGRATGQPPRQPNGNGIFVDLNTASDRARP
 
Nucleotide Sequence: 627 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2826090-2825464 Sphingobium sp. SYK-6 chromosome, complete genome
GTGGCGGCGCTGAAGACGATCGCGGTCGCGCTGGCACTGCTGGTCGCGGCCCCGGCAAGCGCTCGTGTCG
CTGAAGATCCGGTCTCGAGATGGCAGCCGATCATCGCCGAAGCCTCACAGCGCTTCGGCCTACCGGAAGC
CTGGATCATTGCCGTCATGCGCGCCGAAAGCCGCGGAAGGACGACCCTCGATGGCCAACCGATCACCAGC
CGTGCCGGAGCGATGGGCCTGATGCAGCTCATGCCGGGCACCTATGCGGAAATGCGCGGCCGGCTCGGGC
TTGGGCCCGATCCTCATGATCCGCGCGACAACATCCTGGCGGGCGCGGCCTATCTGCGGCTGATGCATGA
TCGGTTCGGCTACCCGGGGCTGTTTGGGGCCTACAATGCCGGCCCAACACGCTATGCGGAGCACCTTCGG
ACGGGCCGTCCGCTTCCGGGCGAGACCCGGGCCTATCTCGCGGTGCTTGCCCGGATGCCATTTTCGCCTG
CCATGCCGCCTGGCATTCTTTCCGGCGACAGGCTGTTTTTCTCTGCGGGCAGGGCTACTGGACAGCCCCC
CCGACAGCCGAATGGCAATGGCATTTTTGTCGATCTAAACACGGCTTCCGACCGCGCGCGACCATAG
 Primer design