SecReT4
Protein ID: 347529000
T4SS name [ID]Trb [315]
Gene symbol-
Locus tagSLG_26150
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]2826078..2826638 [-]
Productconjugal transfer protein TraF
Component typeTraF
UniProt IDG2IJT2
KEGG IDssy:SLG_26150
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 5.4e-43, Aligned region: 49..184
Protein Sequence: 186 a.a.     [Download]
>gi|347529000|ref|YP_004835747.1| conjugal transfer protein TraF [Sphingobium sp. SYK-6]
MSGRGLSRWGDALRDARQRRRTLRHRAAILGIGVACLAATIALPPRQLLVWNTSASAPVGLYAVTAPERI
RTGDMVIAWPPETARRLGAERRYIPFNVPLVKRVAAAPGDRVCASGSALSVNDRTIARRLTTDARGRPMP
WWTGCVTLRDGALLLLMDNPASFDGRYFGPTQADGIIGKAHLLWRR
 
Nucleotide Sequence: 561 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c2826638-2826078 Sphingobium sp. SYK-6 chromosome, complete genome
ATGAGCGGGCGCGGGCTTTCCCGCTGGGGCGATGCGCTGCGGGACGCCAGGCAGCGCCGCCGCACGCTCC
GCCATCGCGCAGCGATCCTCGGGATCGGGGTCGCATGTCTCGCCGCAACGATCGCGCTGCCGCCGCGCCA
GCTACTGGTCTGGAATACATCGGCCAGCGCGCCGGTCGGCCTCTATGCCGTGACCGCGCCCGAGCGAATT
CGGACCGGCGATATGGTGATCGCCTGGCCACCCGAGACCGCGCGCCGGCTTGGTGCGGAGCGCCGCTACA
TCCCCTTCAATGTACCGCTGGTGAAGCGCGTCGCCGCCGCGCCGGGCGACAGGGTCTGCGCATCCGGGTC
GGCGTTGAGCGTCAACGATCGGACAATTGCGCGGCGTCTGACCACCGATGCGCGTGGTCGTCCGATGCCC
TGGTGGACCGGCTGCGTCACCTTGCGCGATGGCGCATTGCTCCTCCTGATGGACAACCCGGCGTCATTCG
ACGGGCGCTATTTCGGGCCGACCCAAGCGGATGGCATCATCGGCAAGGCGCATCTTTTGTGGCGGCGCTG
A
 Primer design