SecReT4
Protein ID: 347529414
T4SS name [ID]Trb [316]
Gene symbol-
Locus tagSLG_30300
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]3276471..3277487 [-]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDG2ILW2
KEGG IDssy:SLG_30300
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7.9e-69, Aligned region: 107..330
Protein Sequence: 338 a.a.     [Download]
>gi|347529414|ref|YP_004836162.1| conjugal transfer protein TrbG [Sphingobium sp. SYK-6]
MTHTPFRRSASAVLLFSATALAGCATTSAKPPAIAYDDPPREIAATPAAEPPRAVEVVTIPEPLPLPGQL
KPVAAGVATSEPADPRRRVGAANAAARVQPVRDGFLNAIQQYPWTDGALYQVYAAPGQVTDIALQEGEQL
VGPGPVAAGDTVRWIIGDTVSGSGAAARVHILVKPTRPDLSTNLIINTDRRTYHLELRATASTYMASVSW
TYPQDQLIALRSANAAAAASASVATGLDLAALNFRYRIEGDRVPWKPVRAFDDSAQVFIEFPAGISQGEM
PPLFVTGAAGDAELVNYRVQGRYMVVDRLFAAAELRLGDRRTEQRVRIVRDDGRRGRP
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c3277487-3276471 Sphingobium sp. SYK-6 chromosome, complete genome
ATGACGCACACGCCATTTCGCCGTTCCGCCTCGGCGGTCCTGCTTTTCTCCGCCACCGCGCTTGCCGGCT
GCGCCACCACATCGGCGAAGCCGCCCGCCATCGCTTATGACGATCCGCCGCGCGAGATCGCGGCGACGCC
GGCCGCGGAACCTCCGCGTGCCGTCGAGGTGGTGACGATCCCCGAACCCCTGCCGCTCCCCGGCCAATTG
AAGCCGGTCGCGGCCGGGGTGGCGACTTCCGAGCCCGCCGATCCGCGCCGCCGCGTCGGGGCCGCCAACG
CCGCCGCCCGCGTGCAGCCGGTGCGAGACGGCTTTCTCAATGCCATCCAGCAATATCCCTGGACGGACGG
CGCGCTCTATCAGGTCTATGCCGCGCCCGGACAGGTGACGGACATCGCCTTGCAAGAAGGCGAGCAGCTC
GTGGGGCCGGGGCCTGTTGCTGCCGGCGATACGGTCAGGTGGATCATCGGCGACACGGTGAGCGGCAGCG
GAGCGGCGGCGCGCGTGCATATCCTCGTGAAGCCGACGCGGCCCGACCTTTCCACGAACCTCATCATCAA
CACCGACCGGCGCACCTATCATCTGGAACTGCGCGCGACGGCTTCGACCTACATGGCGTCCGTCTCGTGG
ACCTATCCGCAGGACCAGCTCATTGCGCTCCGCAGCGCCAATGCCGCAGCCGCCGCCTCGGCCTCCGTCG
CGACCGGCCTCGACCTCGCGGCGCTCAACTTCCGTTACCGGATCGAGGGCGACCGCGTGCCGTGGAAGCC
GGTTCGCGCCTTCGACGATTCCGCCCAGGTGTTCATCGAGTTTCCGGCCGGGATCTCGCAGGGCGAGATG
CCGCCCTTGTTCGTGACCGGCGCGGCTGGCGACGCCGAGCTGGTCAATTACCGCGTGCAGGGCCGCTACA
TGGTGGTGGACAGGCTGTTCGCCGCCGCCGAGCTACGCCTGGGCGACCGGCGCACCGAGCAGCGCGTCCG
TATCGTGCGCGACGATGGGCGCAGGGGGCGGCCATGA
 Primer design