SecReT4
Protein ID: 347529416
T4SS name [ID]Trb [316]
Gene symbol-
Locus tagSLG_30320
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]3278174..3279559 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDG2ILW4
KEGG IDssy:SLG_30320
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.4e-49, Aligned region: 37..262
Protein Sequence: 461 a.a.     [Download]
>gi|347529416|ref|YP_004836164.1| conjugal transfer protein TrbL [Sphingobium sp. SYK-6]
MNDTGVIDDFLSVFTGYIDSGFGLLGGEVAFLSTTLIAIDVTLAGLFWAWGADEDVLQRLVKKTLYIGTF
AFIIGNFALLATIVFESFAGLGLQASGGAMTIDEFMKPGTIAAKGLEAAKPLLDAAGQFSSLWAVFSNLA
LILVLLLAWVIVVLAFFIIAVQVFITLIEFKLVTLAGFVLLPFAFFNKTAFMAEKVLGHVVSTGIKVLVL
AVITGIGTTLFSQFTGAALGPAPDINQVMAIALAALSLLGLSIFGPSIANGIVSAGPQLGAGAAAGTALA
AGGALVGGAAAARLGVGAAGSALGAAGRMTGAAARGGAQMAGGATSAYSLGSLGKSGAGAVAGGVAAVGQ
AAAGSAASAVLSPLRKAAAKGGEAMKSNFRSGTRAGFTATGGTITGGPATAAPAAATAGGSASAGSSAQP
EWAAAMKRRQAVGHGATVIAHTMKAGDSHGGGAGPDIKEKD
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c3279559-3278174 Sphingobium sp. SYK-6 chromosome, complete genome
ATGAACGACACCGGCGTTATCGACGATTTCCTCAGCGTCTTCACCGGCTACATCGACAGCGGATTCGGCC
TGCTCGGCGGCGAGGTCGCGTTCCTCTCGACCACGCTGATCGCCATCGACGTAACGCTCGCCGGCCTGTT
CTGGGCCTGGGGCGCCGACGAGGACGTGCTTCAGCGCCTCGTCAAGAAGACGCTCTATATCGGCACCTTC
GCCTTCATCATTGGCAACTTCGCGCTGCTCGCGACCATCGTGTTCGAGAGCTTCGCCGGGCTCGGCCTCC
AGGCCAGCGGCGGGGCGATGACGATCGATGAGTTCATGAAGCCCGGCACGATCGCGGCGAAGGGGCTCGA
AGCCGCCAAGCCGCTGCTCGATGCGGCGGGGCAGTTCTCCAGCCTTTGGGCCGTGTTCTCGAACCTCGCG
CTGATCCTCGTGCTGCTGCTCGCCTGGGTGATCGTGGTGCTCGCCTTCTTCATCATCGCCGTGCAGGTCT
TCATCACGCTGATCGAGTTCAAGCTGGTGACGCTCGCCGGCTTCGTCCTGCTGCCGTTCGCCTTCTTCAA
CAAGACCGCGTTCATGGCCGAGAAGGTGCTGGGCCATGTCGTCTCGACCGGCATCAAGGTCTTGGTCCTA
GCCGTCATCACCGGCATCGGCACCACGCTGTTCAGCCAGTTCACCGGCGCGGCCCTCGGCCCCGCGCCCG
ACATCAATCAGGTCATGGCCATCGCGCTCGCCGCACTCTCGCTGCTGGGCCTGTCGATCTTCGGTCCCAG
CATCGCCAACGGCATCGTCTCGGCCGGCCCGCAGCTCGGCGCGGGCGCGGCGGCCGGGACCGCGCTGGCC
GCAGGCGGCGCGCTGGTCGGTGGCGCGGCCGCCGCACGGCTTGGCGTGGGCGCCGCCGGTTCGGCCCTCG
GTGCCGCCGGCCGGATGACCGGCGCCGCCGCGCGTGGCGGCGCTCAGATGGCGGGCGGTGCGACCAGCGC
CTACAGCCTCGGCTCGCTGGGCAAGAGCGGCGCGGGCGCTGTTGCGGGCGGCGTGGCTGCGGTCGGCCAG
GCGGCGGCGGGAAGCGCGGCGAGCGCCGTCCTTTCGCCGCTGCGCAAGGCGGCCGCCAAGGGCGGCGAGG
CGATGAAGTCCAACTTCCGCTCGGGCACCCGCGCCGGGTTCACCGCCACCGGCGGCACGATCACCGGCGG
ACCCGCGACCGCCGCCCCGGCCGCCGCAACCGCTGGCGGTTCCGCATCGGCGGGCTCGTCGGCCCAGCCT
GAATGGGCGGCCGCGATGAAACGCCGCCAGGCCGTCGGCCACGGCGCGACCGTCATCGCCCACACCATGA
AGGCCGGCGACAGCCACGGCGGCGGAGCCGGTCCCGACATCAAAGAGAAGGACTGA
 Primer design