SecReT4
Protein ID: 347529421
T4SS name [ID]Trb [316]
Gene symbol-
Locus tagSLG_30370
StrainSphingobium sp. SYK-6
Repliconchromosome [GenBank: NC_015976] [Browse all T4SS(s) in this replicon]
Location [Strand]3283311..3283646 [-]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDG2ILW9
KEGG IDssy:SLG_30370
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.4e-24, Aligned region: 9..100
Protein Sequence: 111 a.a.     [Download]
>gi|347529421|ref|YP_004836169.1| conjugal transfer protein TrbC [Sphingobium sp. SYK-6]
MIHAIRHGARRAMLAATASVVALTISAPAHAGGSSMPWEAPLQSILESIEGPVAKIIAVIIIIITGLTLA
FGDTSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGLVVA
 
Nucleotide Sequence: 336 bp     [Download]
>gi|347526385|ref|NC_015976.1|:c3283646-3283311 Sphingobium sp. SYK-6 chromosome, complete genome
ATGATCCATGCCATTCGGCATGGCGCACGCCGCGCCATGCTCGCCGCCACCGCCAGCGTCGTCGCGCTCA
CCATCTCGGCGCCCGCCCACGCGGGCGGATCGTCGATGCCGTGGGAAGCCCCGCTGCAATCCATCCTCGA
AAGCATCGAAGGGCCAGTCGCGAAAATCATCGCGGTCATCATCATCATTATCACCGGCCTGACCCTGGCG
TTCGGCGATACGTCGGGCGGCTTTCGCCGGCTGATCCAGATCGTCTTCGGCCTGTCGATCGCCTTCGCCG
CGTCGAGCTTCTTCTTGTCGTTCTTTTCGTTCGGCGGGGGGCTCGTCGTCGCATGA
 Primer design