SecReT4
Protein ID: 347626466
T4SS name [ID]VirB [25]
Gene symbol-
Locus tagGLX_30700
StrainGluconacetobacter xylinus NBRC 3288 plasmid pGXY020 (NC_016021)
Repliconplasmid pGXY020 [GenBank: NC_016021] [Browse all T4SS(s) in this replicon]
Location [Strand]9808..10497 [+]
Producttransport secretion system IV VirB8 protein
Component typeVirB8
UniProt IDG2I8I1
KEGG IDgxy:GLX_30700
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 6.5e-44, Aligned region: 22..227
Protein Sequence: 229 a.a.     [Download]
>gi|347626466|ref|YP_004857933.1| transport secretion system IV VirB8 protein [Gluconacetobacter xylinus NBRC 3288]
MTDQKFVPPVPKEKMAEYYEQVENFQKSRARAVVKINKYLTIGLGISLLANVGLAWSVASLLPLEKLVPM
PLWVRPDGTVDSEISMSRLPKTMDEAVVNAAVWQYVRLREGYTYATARYAYDTVSLMSNEQVREQYQSWF
NFPNPKSPQVTVGKRGQIDAERLSLAPIGNNVIQVRFRRIVSMEGARPQTTTWTATVQIQRVTDLPASAR
LANPGGVIVTSYQSSEDGV
 
Nucleotide Sequence: 690 bp     [Download]
>gi|347626458|ref|NC_016021.1|:9808-10497 Gluconacetobacter xylinus NBRC 3288 plasmid pGXY020, complete sequence
ATGACAGATCAGAAATTTGTCCCGCCCGTTCCGAAGGAAAAGATGGCGGAATATTATGAGCAGGTCGAGA
ATTTCCAGAAGTCGCGAGCGCGCGCGGTCGTCAAGATCAATAAGTACCTGACGATCGGCTTAGGAATTTC
ATTGCTGGCTAACGTCGGCTTGGCCTGGTCGGTTGCTTCGCTGTTGCCGTTGGAAAAGCTGGTGCCCATG
CCGTTGTGGGTTCGCCCGGACGGAACGGTTGATAGCGAGATCTCCATGTCACGCTTGCCGAAGACAATGG
ACGAAGCAGTCGTCAATGCAGCGGTGTGGCAATATGTTCGGCTGCGCGAGGGCTATACATATGCCACGGC
GCGCTATGCCTATGACACGGTTTCTCTCATGAGCAACGAACAAGTCAGAGAGCAATATCAGTCGTGGTTT
AATTTCCCCAACCCCAAGAGCCCACAGGTAACGGTTGGAAAAAGGGGCCAGATCGACGCCGAACGTCTGT
CTCTCGCTCCCATTGGCAATAACGTCATTCAGGTGCGCTTCCGGCGCATTGTGTCGATGGAGGGAGCGCG
CCCACAGACGACGACCTGGACCGCGACTGTGCAGATTCAGAGGGTCACGGATCTTCCGGCCAGTGCCCGC
TTGGCAAATCCGGGCGGTGTGATCGTCACGTCCTATCAGTCGTCGGAGGATGGGGTATGA
 Primer design