SecReT4
Protein ID: 347626469
T4SS name [ID]VirB [25]
Gene symbol-
Locus tagGLX_30730
StrainGluconacetobacter xylinus NBRC 3288 plasmid pGXY020 (NC_016021)
Repliconplasmid pGXY020 [GenBank: NC_016021] [Browse all T4SS(s) in this replicon]
Location [Strand]12534..13574 [+]
Producttransport secretion system IV VirB11 protein
Component typeVirB11
UniProt IDG2I8I4
KEGG IDgxy:GLX_30730
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 2.5e-56, Aligned region: 15..313
Protein Sequence: 346 a.a.     [Download]
>gi|347626469|ref|YP_004857936.1| transport secretion system IV VirB11 protein [Gluconacetobacter xylinus NBRC 3288]
MLNEAAVQLRFLMQPLAGWLEDPATEEICVNKPGEVFVRQRGVFTQHALPLSYTDLEDIAILAGALRKQD
VGERHPLCSTELPNGERLQVCLPPAVPAGTVSLTIRRPGGSVAALSSVTKRYNIARWNRWDKRTEAEEKR
HEEVLRYYDEGNFEAFLAACVRNRMTMLLCGATGSGKTTMGRTLISAIPLHERLITIEDTLELVIPHPNH
VRLLYSKSGTGISSVSAEDLLHASLRMRPDRILPAELRDDAAWTYLNEVVSGHPGSISTIHGANPVQAFK
KLFSLIKGSPQGAALEDKTLVDMLSAAIDVIVPFETTGEIYSIGEVWLAADARRRGETAADLLTKY
 
Nucleotide Sequence: 1041 bp     [Download]
>gi|347626458|ref|NC_016021.1|:12534-13574 Gluconacetobacter xylinus NBRC 3288 plasmid pGXY020, complete sequence
ATGCTCAATGAAGCAGCGGTACAGCTCCGTTTCCTGATGCAGCCCCTTGCGGGCTGGCTCGAAGACCCGG
CGACGGAAGAGATCTGCGTTAATAAGCCCGGAGAGGTTTTTGTTCGGCAGAGGGGTGTGTTTACACAACA
CGCTCTTCCCTTGAGCTATACGGATCTGGAAGACATCGCGATCCTGGCAGGAGCTTTGCGCAAACAGGAC
GTGGGTGAACGGCATCCTCTGTGCTCTACCGAGTTGCCAAACGGGGAGCGTCTGCAAGTGTGTTTGCCGC
CAGCCGTACCCGCGGGGACGGTGAGCCTGACGATCCGGCGGCCAGGGGGGAGTGTGGCTGCCCTCAGTTC
CGTGACAAAGCGGTACAACATTGCGCGTTGGAACCGCTGGGATAAACGGACAGAGGCCGAAGAGAAACGG
CACGAAGAGGTTCTGCGGTATTACGATGAAGGCAATTTCGAAGCCTTCCTCGCTGCGTGTGTACGGAACC
GTATGACCATGCTGCTGTGCGGGGCGACGGGCTCTGGAAAGACCACGATGGGCCGAACGCTGATTTCGGC
CATTCCGCTGCATGAGCGGCTGATAACGATCGAAGACACGTTAGAGCTTGTTATTCCGCACCCCAACCAT
GTGCGGTTGCTCTATTCAAAGTCGGGAACAGGAATCAGCTCGGTCAGTGCGGAAGACCTTTTGCACGCAA
GTCTGCGCATGAGACCGGATCGGATCTTGCCGGCGGAGCTTCGCGACGACGCCGCATGGACATATCTCAA
TGAGGTCGTATCGGGGCATCCCGGTTCGATTTCTACCATTCATGGCGCAAATCCGGTTCAGGCGTTCAAG
AAGCTCTTCTCGCTTATCAAGGGCTCGCCCCAGGGGGCGGCGCTAGAAGACAAAACTCTTGTGGACATGC
TCTCCGCCGCGATTGACGTAATCGTGCCCTTCGAGACGACAGGCGAGATCTATTCCATCGGCGAAGTGTG
GCTGGCAGCGGATGCGCGCCGTAGAGGCGAGACAGCAGCAGATCTTCTGACGAAATACTGA
 Primer design