SecReT4
Protein ID: 347626470
T4SS name [ID]VirB [25]
Gene symboltraG
Locus tagGLX_30740
StrainGluconacetobacter xylinus NBRC 3288 plasmid pGXY020 (NC_016021)
Repliconplasmid pGXY020 [GenBank: NC_016021] [Browse all T4SS(s) in this replicon]
Location [Strand]13588..15408 [+]
Productconjugal transfer protein TraG
Component typeVirD4
UniProt IDG2I8I5
KEGG IDgxy:GLX_30740
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-72, Aligned region: 139..599
TraG-D_C [PF12696], Evalue: 1.9e-26, Aligned region: 435..561
TrwB_AAD_bind [PF10412], Evalue: 3.3e-15, Aligned region: 405..576
Protein Sequence: 606 a.a.     [Download]
>gi|347626470|ref|YP_004857937.1| conjugal transfer protein TraG [Gluconacetobacter xylinus NBRC 3288]
MASENKSIVLIARIILGILMVFVSWTVVASFVFLKGTGLSGSFEHPFYQWWLYFLYGRDNPIVVQWLKIG
AGAGGVVVALVMLAVIFRRGAIGPSLRPSIFSRRQRPIRGVTENHGYADWMTMKQARQLFPRPSAEYGGV
VVGEAYRVDEDRHARVPFHPKEPKTWGQGGRAPLLIDPCETGSTHSLVFAGPGSFKSTSAVTTLTTWTGS
AVVLDPSTELGPMLRPFRETLGHQVYELRLGGDVGFNVLDWIDIRSPEAITNIQDVVSWICRESGAKKDA
NNEFFDRQGRNLVTCLLAHMMFDPDLPAEEKTLRTLRSGVCTPQEEMRNLLNTIHASSPCAYASQTAGAL
KGLVDETFSGVYGNADDKTAWLSNPAFADLVSGDSFRSSDLVDGKMDVFVQLPLRALENTPEIGRTIIGA
LLNAVYEADGNIRNRVLFLLDEVARLGPMRIMATARDAGRKYGITLRLLYQSVGQLEEQWGREGKRAWYE
AAAHRTYVAISDLDTAKELEETFGQYGVMATSVGSNTGTSGKGWEASNRSRGANTSYHEISRPLIRREEL
LNDVRVDEAFVVVRGGRPLRCGMPIYFRRPEIREKIAANRFNKISA
 
Nucleotide Sequence: 1821 bp     [Download]
>gi|347626458|ref|NC_016021.1|:13588-15408 Gluconacetobacter xylinus NBRC 3288 plasmid pGXY020, complete sequence
ATGGCGTCAGAAAACAAGTCGATCGTCTTGATCGCCCGGATTATCCTCGGAATTCTGATGGTATTTGTGT
CTTGGACCGTTGTCGCGTCTTTTGTTTTTCTGAAGGGAACGGGTTTATCGGGCTCGTTCGAGCATCCTTT
CTATCAATGGTGGCTCTATTTTCTGTATGGCCGGGATAATCCGATCGTAGTGCAATGGCTCAAGATCGGC
GCGGGGGCAGGCGGTGTTGTGGTTGCGCTGGTAATGCTGGCGGTGATCTTCCGGCGTGGTGCAATCGGCC
CTTCTCTGCGCCCGTCCATATTCAGTCGAAGGCAACGGCCTATCCGTGGCGTGACAGAGAATCATGGCTA
TGCGGACTGGATGACAATGAAGCAGGCCAGGCAGCTCTTTCCACGTCCTTCCGCTGAATATGGAGGTGTC
GTTGTAGGCGAAGCCTATCGCGTGGACGAAGACCGGCATGCAAGGGTGCCCTTTCATCCTAAAGAGCCGA
AAACATGGGGACAGGGCGGCCGTGCGCCATTGCTCATAGATCCCTGTGAGACAGGATCGACCCACAGTCT
GGTTTTTGCCGGACCGGGATCGTTCAAGTCCACGTCGGCCGTCACCACGCTGACCACATGGACGGGCTCT
GCCGTGGTGCTTGATCCGAGTACAGAATTGGGGCCGATGCTTCGACCGTTCCGCGAAACGCTGGGTCATC
AGGTCTACGAGCTGCGGCTCGGTGGAGATGTTGGCTTTAATGTCTTGGACTGGATCGACATTCGTTCGCC
CGAAGCAATCACGAATATACAGGACGTGGTGTCATGGATATGCCGGGAGAGTGGTGCCAAAAAAGACGCC
AATAACGAGTTTTTTGACCGGCAGGGCCGCAATCTCGTGACGTGTTTATTGGCGCACATGATGTTTGATC
CGGACCTTCCAGCCGAGGAAAAGACCTTGCGGACGCTGAGAAGCGGGGTCTGCACGCCGCAAGAAGAAAT
GCGGAATCTGCTGAACACGATCCATGCGAGCAGTCCGTGCGCCTATGCGAGCCAGACGGCCGGCGCGCTC
AAGGGACTGGTCGATGAGACGTTTTCCGGGGTGTATGGCAATGCCGATGACAAGACAGCCTGGCTCAGTA
ATCCTGCGTTTGCGGACCTGGTGTCCGGAGACAGTTTTCGCTCGTCAGATCTGGTCGATGGCAAGATGGA
TGTTTTCGTACAGTTGCCATTGCGGGCTTTGGAAAACACACCCGAAATTGGTCGCACGATTATAGGGGCG
TTACTGAATGCCGTTTATGAAGCTGATGGCAATATTCGGAATCGTGTCCTCTTCCTTCTGGACGAAGTCG
CACGTCTCGGTCCTATGCGGATCATGGCAACAGCACGGGATGCCGGGCGCAAATACGGTATTACCCTGAG
ATTGCTCTATCAGTCGGTCGGACAACTCGAAGAACAATGGGGCCGTGAGGGAAAGCGAGCATGGTACGAG
GCGGCCGCACATCGGACATATGTTGCGATCTCCGATCTCGATACCGCGAAAGAGCTGGAAGAAACCTTCG
GTCAGTATGGTGTCATGGCGACATCCGTGGGCAGCAATACCGGCACGTCGGGGAAAGGCTGGGAAGCGAG
CAACCGTTCGCGCGGGGCGAACACGAGCTATCACGAAATCAGCCGCCCGCTGATCCGACGGGAAGAACTG
CTGAACGATGTCCGGGTAGATGAAGCGTTTGTGGTGGTGCGTGGTGGTCGTCCGTTGCGTTGCGGGATGC
CTATCTATTTTCGACGGCCTGAAATCAGAGAAAAAATAGCGGCCAATCGGTTCAATAAGATCTCGGCCTG
A
 Primer design