SecReT4
Protein ID: 348589250
T4SS name [ID]Tra_F [81]
Gene symboltraL
Locus tagPHK17A_p061
StrainEscherichia coli plasmid pHK17a (NC_016039)
Repliconplasmid pHK17a [GenBank: NC_016039] [Browse all T4SS(s) in this replicon]
Location [Strand]35142..35453 [+]
Productprotein TraL
Component typeTraL_F
UniProt IDB7LJ57, C8CGP9
KEGG IDeum:p1ECUMN_0110
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.2e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|348589250|ref|YP_004870053.1| protein TraL [Escherichia coli]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGIITSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|348589192|ref|NC_016039.1|:35142-35453 Escherichia coli plasmid pHK17a, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCATAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design